Human COPS5/CSN5/JAB1 ORF/cDNA clone-Lentivirus plasmid (BC001859.2)
Cat. No.: pGMLP003876
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human COPS5/CSN5/JAB1 Lentiviral expression plasmid for COPS5 lentivirus packaging, COPS5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
COPS5/CSN5 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003876 |
Gene Name | COPS5 |
Accession Number | BC001859.2 |
Gene ID | 10987 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1005 bp |
Gene Alias | CSN5,JAB1,MGC3149,MOV-34,SGN5 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCGGCGTCCGGGAGCGGTATGGCCCAGAAAACCTGGGAACTGGCCAACAACATGCAGGAAGCTCAGAGTATCGATGAAATCTACAAATACGACAAGAAACAGCAGCAAGAAATCCTGGCGGCGAAGCCCTGGACTAAGGATCACCATTACTTTAAGTACTGCAAAATCTCAGCATTGGCTCTGCTGAAGATGGTGATGCATGCCAGATCGGGAGGCAACTTGGAAGTGATGGGTCTGATGCTAGGAAAGGTGGATGGTGAAACCATGATCATTATGGACAGTTTTGCTTTGCCTGTGGAGGGCACTGAAACCCGAGTAAATGCTCAGGCTGCTGCATATGAATACATGGCTGCATACATAGAAAATGCAAAACAGGTTGGCCGCCTTGAAAATGCAATCGGGTGGTATCATAGCCACCCTGGCTATGGCTGCTGGCTTTCTGGGATTGATGTTAGTACTCAGATGCTCAATCAGCAGTTCCAGGAACCATTTGTAGCAGTGGTGATTGATCCAACAAGAACAATATCCGCAGGGAAAGTGAATCTTGGCGCCTTTAGGACATACCCAAAGGGCTACAAACCTCCTGATGAAGGACCTTCTGAGTACCAGACTATTCCACTTAATAAAATAGAAGATTTTGGTGTACACTGCAAACAATATTATGCCTTAGAAGTCTCATATTTCAAATCCTCTTTGGATCGCAAATTGCTTGAGCTGTTGTGGAATAAATACTGGGTGAATACGTTGAGTTCTTCTAGCTTGCTTACTAATGCAGACTATACCACTGGTCAGGTCTTTGATTTGTCTGAAAAGTTAGAGCAGTCAGAAGCCCAGCTGGGACGAGGGAGTTTCATGTTGGGTTTAGAAACGCATGACCGAAAATCAGAAGACAAACTTGCCAAAGCTACAAGAGACAGCTGTAAAACTACCATAGAAGCTATCCATGGATTGATGTCTCAGGTTATTAAGGATAAACTGTTTAATCAAATTAACATCTCTTAA |
ORF Protein Sequence | MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T84791-Ab | Anti-COPS5 monoclonal antibody |
Target Antigen | GM-Tg-g-T84791-Ag | COPS5 protein |
ORF Viral Vector | pGMLP000130 | Human COPS5 Lentivirus plasmid |
ORF Viral Vector | pGMLP003876 | Human COPS5 Lentivirus plasmid |
ORF Viral Vector | vGMLP000130 | Human COPS5 Lentivirus particle |
ORF Viral Vector | vGMLP003876 | Human COPS5 Lentivirus particle |
Target information
Target ID | GM-T84791 |
Target Name | COPS5 |
Gene ID | 10987, 26754, 704584, 312916, 101092084, 477901, 507179, 100051846 |
Gene Symbol and Synonyms | COPS5,CSN5,JAB1,MOV-34,Mov34,SGN5 |
Uniprot Accession | Q92905 |
Uniprot Entry Name | CSN5_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Cancer |
Gene Ensembl | ENSG00000121022 |
Target Classification | Tumor-associated antigen (TAA) |
The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.