Human SLC39A3/ZIP-3/ZIP3 ORF/cDNA clone-Lentivirus plasmid (NM_213568)

Cat. No.: pGMLP000170
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SLC39A3/ZIP-3/ZIP3 Lentiviral expression plasmid for SLC39A3 lentivirus packaging, SLC39A3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SLC39A3/ZIP-3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000170
Gene Name SLC39A3
Accession Number NM_213568
Gene ID 29985
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 318 bp
Gene Alias ZIP-3,ZIP3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGAAATTGCTAGTGGCCAAAATCCTGTGCATGGTGGGCGTGTTCTTCTTCATGCTGCTCGGCTCCCTGCTCCCCGTGAAGATCATCGAGACAGATTTTGAGAAGGCCCATCGCTCGAAAAAGATCCTCTCTCTCTGCAACACCTTTGGAGGAGGGGTGTTTCTGGCCACGTGCTTCAACGCTCTGCTGCCCGCTGTGAGGGAAAAGGTAAGGGCTCCCTGGGCACTAGCAGCAGCCCTTGGCACCTTATGGCCAAGGGACTCTGATGCATTTTCAACACTGATGCCAAGTTCAGTGAAGGCCTTGATGCTGTAA
ORF Protein Sequence MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCFNALLPAVREKVRAPWALAAALGTLWPRDSDAFSTLMPSSVKALML

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1617-Ab Anti-S39A3/ SLC39A3/ ZIP-3 monoclonal antibody
    Target Antigen GM-Tg-g-MP1617-Ag SLC39A3 VLP (virus-like particle)
    ORF Viral Vector pGMLP000170 Human SLC39A3 Lentivirus plasmid
    ORF Viral Vector vGMLP000170 Human SLC39A3 Lentivirus particle


    Target information

    Target ID GM-MP1617
    Target Name SLC39A3
    Gene ID 29985, 106947, 711564, 314637, 101088725, 612127, 505294, 100146878
    Gene Symbol and Synonyms SLC39A3,ZIP-3,ZIP3
    Uniprot Accession Q9BRY0
    Uniprot Entry Name S39A3_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000141873
    Target Classification Not Available

    Predicted to enable zinc ion transmembrane transporter activity. Predicted to be involved in zinc ion transmembrane transport. Predicted to act upstream of or within several processes, including T cell homeostasis; chordate embryonic development; and zinc ion transport. Predicted to be integral component of membrane. Predicted to be active in plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.