Human SYT7/IPCA-7/IPCA7 ORF/cDNA clone-Lentivirus plasmid (NM_004200)

Cat. No.: pGMLP000242
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SYT7/IPCA-7/IPCA7 Lentiviral expression plasmid for SYT7 lentivirus packaging, SYT7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SYT7/IPCA-7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $639.36
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000242
Gene Name SYT7
Accession Number NM_004200
Gene ID 9066
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1212 bp
Gene Alias IPCA-7,IPCA7,PCANAP7,SYT-VII,SYTVII
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTACCGGGACCCGGAGGCGGCCAGCCCAGGGGCGCCCTCGCGCGACGTCCTGCTGGTCTCTGCCATCATCACCGTCAGCCTTAGCGTCACTGTCGTCCTCTGCGGCCTCTGCCACTGGTGTCAGCGCAAACTGGGCAAACGCTACAAGAATTCCTTGGAGACGGTGGGCACGCCAGACTCAGGGCGTGGGCGCAGTGAGAAGAAGGCTATCAAGTTGCCTGCAGGAGGGAAGGCGGTGAACACAGCCCCCGTGCCAGGCCAGACACCCCACGATGAGTCCGACCGCCGGACCGAGCCACGTTCCTCCGTCTCAGACCTCGTCAACTCCCTCACCAGCGAGATGCTCATGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGATTGCCCGTCCCCGGCAGCCCGTGGCCCAGTGGCACCAGCTGAAGGCCTGA
ORF Protein Sequence MYRDPEAASPGAPSRDVLLVSAIITVSLSVTVVLCGLCHWCQRKLGKRYKNSLETVGTPDSGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDKLSRNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLKA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1749-Ab Anti-SYT7/ IPCA-7/ IPCA7 monoclonal antibody
    Target Antigen GM-Tg-g-MP1749-Ag SYT7 VLP (virus-like particle)
    ORF Viral Vector pGMLP000242 Human SYT7 Lentivirus plasmid
    ORF Viral Vector vGMLP000242 Human SYT7 Lentivirus particle


    Target information

    Target ID GM-MP1749
    Target Name SYT7
    Gene ID 9066, 54525, 722368, 59267, 101084826, 483796, 540850, 100062526
    Gene Symbol and Synonyms B230112P13Rik,IPCA-7,IPCA7,PCANAP7,SYT-VII,SYT7,SYTVII
    Uniprot Accession O43581
    Uniprot Entry Name SYT7_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000011347
    Target Classification Not Available

    This gene is a member of the synaptotagmin gene family and encodes a protein similar to other family members that mediate calcium-dependent regulation of membrane trafficking in synaptic transmission. A similar protein in rodents mediates hormone secretion and lysosome exocytosis. In humans, expression of this gene has been associated with prostate cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.