Human GADD45B/GADD45BETA/MYD118 ORF/cDNA clone-Lentivirus plasmid (NM_015675)

Cat. No.: pGMLP000253
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GADD45B/GADD45BETA/MYD118 Lentiviral expression plasmid for GADD45B lentivirus packaging, GADD45B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to GADD45B/GADD45BETA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000253
Gene Name GADD45B
Accession Number NM_015675
Gene ID 4616
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 483 bp
Gene Alias GADD45BETA,MYD118
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACGCTGGAAGAGCTCGTGGCGTGCGACAACGCGGCGCAGAAGATGCAGACGGTGACCGCCGCGGTGGAGGAGCTTTTGGTGGCCGCTCAGCGCCAGGATCGCCTCACAGTGGGGGTGTACGAGTCGGCCAAGTTGATGAATGTGGACCCAGACAGCGTGGTCCTCTGCCTCTTGGCCATTGACGAGGAGGAGGAGGATGACATCGCCCTGCAAATCCACTTCACGCTCATCCAGTCCTTCTGCTGTGACAACGACATCAACATCGTGCGGGTGTCGGGCATGCAGCGCCTGGCGCAGCTCCTGGGAGAGCCGGCCGAGACCCAGGGCACCACCGAGGCCCGAGACCTGCATTGTCTCCTGGTCACGAACCCTCACACGGACGCCTGGAAGAGCCACGGCTTGGTGGAGGTGGCCAGCTACTGCGAAGAAAGCCGGGGCAACAACCAGTGGGTCCCCTACATCTCTCTTCAGGAACGCTGA
ORF Protein Sequence MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T70797-Ab Anti-GADD45B monoclonal antibody
    Target Antigen GM-Tg-g-T70797-Ag GADD45B protein
    ORF Viral Vector pGMLP000253 Human GADD45B Lentivirus plasmid
    ORF Viral Vector vGMLP000253 Human GADD45B Lentivirus particle


    Target information

    Target ID GM-T70797
    Target Name GADD45B
    Gene ID 4616, 17873, 711257, 299626, 101087971, 485069, 618405, 100059768
    Gene Symbol and Synonyms GADD45B,GADD45BETA,MYD118
    Uniprot Accession O75293
    Uniprot Entry Name GA45B_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Prostate Cancer
    Gene Ensembl ENSG00000099860
    Target Classification Not Available

    This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway.  This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.