Human GADD45B/GADD45BETA/MYD118 ORF/cDNA clone-Lentivirus particle (NM_015675)
Cat. No.: vGMLP000253
Pre-made Human GADD45B/GADD45BETA/MYD118 Lentiviral expression plasmid for GADD45B lentivirus packaging, GADD45B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
GADD45B/GADD45BETA products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000253 | Human GADD45B Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000253 |
| Gene Name | GADD45B |
| Accession Number | NM_015675 |
| Gene ID | 4616 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 483 bp |
| Gene Alias | GADD45BETA,MYD118 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGACGCTGGAAGAGCTCGTGGCGTGCGACAACGCGGCGCAGAAGATGCAGACGGTGACCGCCGCGGTGGAGGAGCTTTTGGTGGCCGCTCAGCGCCAGGATCGCCTCACAGTGGGGGTGTACGAGTCGGCCAAGTTGATGAATGTGGACCCAGACAGCGTGGTCCTCTGCCTCTTGGCCATTGACGAGGAGGAGGAGGATGACATCGCCCTGCAAATCCACTTCACGCTCATCCAGTCCTTCTGCTGTGACAACGACATCAACATCGTGCGGGTGTCGGGCATGCAGCGCCTGGCGCAGCTCCTGGGAGAGCCGGCCGAGACCCAGGGCACCACCGAGGCCCGAGACCTGCATTGTCTCCTGGTCACGAACCCTCACACGGACGCCTGGAAGAGCCACGGCTTGGTGGAGGTGGCCAGCTACTGCGAAGAAAGCCGGGGCAACAACCAGTGGGTCCCCTACATCTCTCTTCAGGAACGCTGA |
| ORF Protein Sequence | MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T70797-Ab | Anti-GADD45B monoclonal antibody |
| Target Antigen | GM-Tg-g-T70797-Ag | GADD45B protein |
| ORF Viral Vector | pGMLP000253 | Human GADD45B Lentivirus plasmid |
| ORF Viral Vector | vGMLP000253 | Human GADD45B Lentivirus particle |
Target information
| Target ID | GM-T70797 |
| Target Name | GADD45B |
| Gene ID | 4616, 17873, 711257, 299626, 101087971, 485069, 618405, 100059768 |
| Gene Symbol and Synonyms | GADD45B,GADD45BETA,MYD118 |
| Uniprot Accession | O75293 |
| Uniprot Entry Name | GA45B_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | Prostate Cancer |
| Gene Ensembl | ENSG00000099860 |
| Target Classification | Not Available |
This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


