Human S100A16/AAG13/DT1P1A7 ORF/cDNA clone-Lentivirus plasmid (NM_080388)

Cat. No.: pGMLP000394
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human S100A16/AAG13/DT1P1A7 Lentiviral expression plasmid for S100A16 lentivirus packaging, S100A16 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to S100A16/AAG13 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000394
Gene Name S100A16
Accession Number NM_080388
Gene ID 140576
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 312 bp
Gene Alias AAG13,DT1P1A7,S100F
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCAGACTGCTACACGGAGCTGGAGAAGGCAGTCATTGTCCTGGTGGAAAACTTCTACAAATATGTGTCTAAGTACAGCCTGGTCAAGAACAAGATCAGCAAGAGCAGCTTCCGCGAGATGCTCCAGAAAGAGCTGAACCACATGCTGTCGGACACAGGGAACCGGAAGGCTGCGGATAAGCTCATCCAGAACCTGGATGCCAATCATGATGGGCGCATCAGCTTCGATGAGTACTGGACCTTGATAGGCGGCATCACCGGCCCCATCGCCAAACTCATCCATGAGCAGGAGCAGCAGAGCAGCAGCTAG
ORF Protein Sequence MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2315-Ab Anti-S10AG/ S100A16/ AAG13 monoclonal antibody
    Target Antigen GM-Tg-g-MP2315-Ag S100A16 VLP (virus-like particle)
    ORF Viral Vector pGMLP000394 Human S100A16 Lentivirus plasmid
    ORF Viral Vector vGMLP000394 Human S100A16 Lentivirus particle


    Target information

    Target ID GM-MP2315
    Target Name S100A16
    Gene ID 140576, 67860, 713638, 361991, 101082624, 490458, 505679, 100056268
    Gene Symbol and Synonyms 2300002L21Rik,AAG13,DT1P1A7,S100A16,S100F
    Uniprot Accession Q96FQ6
    Uniprot Entry Name S10AG_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000188643
    Target Classification Not Available

    Enables calcium ion binding activity and protein homodimerization activity. Predicted to act upstream of or within response to calcium ion. Located in several cellular components, including cytosol; extracellular space; and nucleolus. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.