Human MMGT1/EMC5/TMEM32 ORF/cDNA clone-Lentivirus plasmid (NM_001330000)

Cat. No.: pGMLP000402
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MMGT1/EMC5/TMEM32 Lentiviral expression plasmid for MMGT1 lentivirus packaging, MMGT1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to MMGT1/EMC5 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000402
Gene Name MMGT1
Accession Number NM_001330000
Gene ID 93380
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 396 bp
Gene Alias EMC5,TMEM32
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGCCGTCGCTGTGGAAGGGGCTGGTGGGCATCGGTCTCTTTGCCCTAGCCCACGCCGCCTTTTCCGCTGCGCAGCATCGTTCTTATATGCGATTAACAGAAAAAGAAGATGAATCACTGCCAATAGATATAGTTCTTCAGACACTTCTGGCCTTTGCAGTTACCTGTTACGGTATAGTTCATATTGCAGGAGAGTTTAAAGACATGGATGCCACTTCAGAACTGAAAAATAAGACATTTGATACGTTAAGGAATCACCCATCCTTTTATGTATTTAATCATCGTGGTCGAGTACTTTTCCGGCCTTCGGATACAGCAAATTCTTCAAACCAAGATGCATTGTCCTCTAACACATCATTGAAGTTACGAAAACTCGAATCACTGCGTCGTTAA
ORF Protein Sequence MAPSLWKGLVGIGLFALAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0819-Ab Anti-EMC5/ MMGT1/ TMEM32 monoclonal antibody
    Target Antigen GM-Tg-g-MP0819-Ag MMGT1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000402 Human MMGT1 Lentivirus plasmid
    ORF Viral Vector vGMLP000402 Human MMGT1 Lentivirus particle


    Target information

    Target ID GM-MP0819
    Target Name MMGT1
    Gene ID 93380, 236792, 710338, 302864, 101097549, 611935, 617557, 100054769
    Gene Symbol and Synonyms 9630048L06Rik,EMC5,mir-5116,Mir5116,MMGT1,RGD1566339,TMEM32
    Uniprot Accession Q8N4V1
    Uniprot Entry Name EMC5_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000169446
    Target Classification Not Available

    Contributes to membrane insertase activity. Involved in protein insertion into ER membrane by stop-transfer membrane-anchor sequence and tail-anchored membrane protein insertion into ER membrane. Is integral component of endoplasmic reticulum membrane. Part of EMC complex. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.