Human PENK/PE/PENK-A ORF/cDNA clone-Lentivirus plasmid (NM_001135690)

Cat. No.: pGMLP000462
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PENK/PE/PENK-A Lentiviral expression plasmid for PENK lentivirus packaging, PENK lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PENK/PE products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $501
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000462
Gene Name PENK
Accession Number NM_001135690
Gene ID 5179
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 804 bp
Gene Alias PE,PENK-A
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGCGGTTCCTGACACTTTGCACTTGGCTGCTGTTGCTCGGCCCCGGGCTCCTGGCGACCGTGCGGGCCGAATGCAGCCAGGATTGCGCGACGTGCAGCTACCGCCTAGTGCGCCCGGCCGACATCAACTTCCTGGCTTGCGTAATGGAATGTGAAGGTAAACTGCCTTCTCTGAAAATTTGGGAAACCTGCAAGGAGCTCCTGCAGCTGTCCAAACCAGAGCTTCCTCAAGATGGCACCAGCACCCTCAGAGAAAATAGCAAACCGGAAGAAAGCCATTTGCTAGCCAAAAGGTATGGGGGCTTCATGAAAAGGTATGGAGGCTTCATGAAGAAAATGGATGAGCTTTATCCCATGGAGCCAGAAGAAGAGGCCAATGGAAGTGAGATCCTCGCCAAGCGGTATGGGGGCTTCATGAAGAAGGATGCAGAGGAGGACGACTCGCTGGCCAATTCCTCAGACCTGCTAAAAGAGCTTCTGGAAACAGGGGACAACCGAGAGCGTAGCCACCACCAGGATGGCAGTGATAATGAGGAAGAAGTGAGCAAGAGATATGGGGGCTTCATGAGAGGCTTAAAGAGAAGCCCCCAACTGGAAGATGAAGCCAAAGAGCTGCAGAAGCGATATGGGGGCTTCATGAGAAGAGTAGGTCGCCCAGAGTGGTGGATGGACTACCAGAAACGGTATGGAGGTTTCCTGAAGCGCTTTGCCGAGGCTCTGCCCTCCGACGAAGAAGGCGAAAGTTACTCCAAAGAAGTTCCTGAAATGGAAAAAAGATACGGAGGATTTATGAGATTTTAA
ORF Protein Sequence MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2559-Ab Anti-PENK/ PE-A monoclonal antibody
    Target Antigen GM-Tg-g-MP2559-Ag PENK VLP (virus-like particle)
    ORF Viral Vector pGMLP000462 Human PENK Lentivirus plasmid
    ORF Viral Vector pGMAP000398 Human PENK Adenovirus plasmid
    ORF Viral Vector vGMLP000462 Human PENK Lentivirus particle
    ORF Viral Vector vGMAP000398 Human PENK Adenovirus particle


    Target information

    Target ID GM-MP2559
    Target Name PENK
    Gene ID 5179, 18619, 696649, 29237, 101098113, 100687307, 281387, 100067723
    Gene Symbol and Synonyms ENK,PE,PENK,PENK-A,Penk-rs,Penk1,Penk2,PPA
    Uniprot Accession P01210
    Uniprot Entry Name PENK_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000181195
    Target Classification Not Available

    This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the pentapeptide opioids Met-enkephalin and Leu-enkephalin, which are stored in synaptic vesicles, then released into the synapse where they bind to mu- and delta-opioid receptors to modulate the perception of pain. Other non-opioid cleavage products may function in distinct biological activities. [provided by RefSeq, Jul 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.