Human PENK ORF/cDNA clone-Adenovirus particle (BC032505)
Cat. No.: vGMAP000398
Pre-made Human PENK/ Adenovirus for PENK overexpression in-vitro and in-vivo. The PENK adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified PENK-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
PENK/ products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
vGMAP000398 | Human PENK Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
5E+10PFU (1E+10pfu/ml×5ml) | |||
1E+11PFU (1E+10pfu/ml×10ml) | |||
Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMAP000398 |
Gene Name | PENK |
Accession Number | BC032505 |
Gene ID | 5179 |
Species | Human |
Product Type | Adenovirus particle (overexpression) |
Insert Length | 804 bp |
Gene Alias | |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCGCGGTTCCTGACACTTTGCACTTGGCTGCTGTTGCTCGGCCCCGGGCTCCTGGCGACCGTGCGGGCCGAATGCAGCCAGGATTGCGCGACGTGCAGCTACCGCCTAGTGCGCCCGGCCGACATCAACTTCCTGGCTTGCGTAATGGAATGTGAAGGTAAACTGCCTTCTCTGAAAATTTGGGAAACCTGCAAGGAGCTCCTGCAGCTGTCCAAACCAGAGCTTCCTCAAGATGGCACCAGCACCCTCAGAGAAAATAGCAAACCGGAAGAAAGCCATTTGCTAGCCAAAAGGTATGGGGGCTTCATGAAAAGGTATGGAGGCTTCATGAAGAAAATGGATGAGCTTTATCCCATGGAGCCAGAAGAAGAGGCCAATGGAAGTGAGATCCTCGCCAAGCGGTATGGGGGCTTCATGAAGAAGGATGCAGAGGAGGACGACTCGCTGGCCAATTCCTCAGACCTGCTAAAAGAGCTTCTGGAAACAGGGGACAACCGAGAGCGTAGCCACCACCAGGATGGCAGTGATAATGAGGAAGAAGTGAGCAAGAGATATGGGGGCTTCATGAGAGGCTTAAAGAGAAGCCCCCAACTGGAAGATGAAGCCAAAGAGCTGCAGAAGCGATATGGGGGCTTCATGAGAAGAGTAGGTCGCCCAGAGTGGTGGATGGACTACCAGAAACGGTATGGAGGTTTCCTGAAGCGCTTTGCCGAGGCTCTGCCCTCCGACGAAGAAGGCGAAAGTTACTCCAAAGAAGTTCCTGAAATGGAAAAAAGATACGGAGGATTTATGAGATTTTAA |
ORF Protein Sequence | MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP2559-Ab | Anti-PENK/ PE-A monoclonal antibody |
Target Antigen | GM-Tg-g-MP2559-Ag | PENK VLP (virus-like particle) |
ORF Viral Vector | pGMLP000462 | Human PENK Lentivirus plasmid |
ORF Viral Vector | pGMAP000398 | Human PENK Adenovirus plasmid |
ORF Viral Vector | vGMLP000462 | Human PENK Lentivirus particle |
ORF Viral Vector | vGMAP000398 | Human PENK Adenovirus particle |
Target information
Target ID | GM-MP2559 |
Target Name | PENK |
Gene ID | 5179, 18619, 696649, 29237, 101098113, 100687307, 281387, 100067723 |
Gene Symbol and Synonyms | ENK,PE,PENK,PENK-A,Penk-rs,Penk1,Penk2,PPA |
Uniprot Accession | P01210 |
Uniprot Entry Name | PENK_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000181195 |
Target Classification | Not Available |
This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the pentapeptide opioids Met-enkephalin and Leu-enkephalin, which are stored in synaptic vesicles, then released into the synapse where they bind to mu- and delta-opioid receptors to modulate the perception of pain. Other non-opioid cleavage products may function in distinct biological activities. [provided by RefSeq, Jul 2015]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.