Human VAMP5 ORF/cDNA clone-Lentivirus plasmid (NM_006634)

Cat. No.: pGMLP000537
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human VAMP5/ Lentiviral expression plasmid for VAMP5 lentivirus packaging, VAMP5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to VAMP5/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000537
Gene Name VAMP5
Accession Number NM_006634
Gene ID 10791
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 351 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGGAATAGAGTTGGAGCGGTGCCAGCAGCAGGCGAACGAGGTGACGGAAATTATGCGTAACAACTTCGGCAAGGTCCTGGAGCGTGGTGTGAAGCTGGCCGAACTGCAGCAGCGTTCAGACCAACTCCTGGATATGAGCTCAACCTTCAACAAGACTACACAGAACCTGGCCCAGAAGAAGTGCTGGGAGAACATCCGTTACCGGATCTGCGTGGGGCTGGTGGTGGTTGGTGTCCTGCTCATCATCCTGATTGTGCTGCTGGTCGTCTTTCTCCCTCAGAGCAGTGACAGCAGTAGTGCCCCACGGACCCAGGATGCAGGCATTGCCTCAGGGCCTGGGAACTGA
ORF Protein Sequence MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1913-Ab Anti-VAMP5 monoclonal antibody
    Target Antigen GM-Tg-g-MP1913-Ag VAMP5 VLP (virus-like particle)
    ORF Viral Vector pGMLP000537 Human VAMP5 Lentivirus plasmid
    ORF Viral Vector vGMLP000537 Human VAMP5 Lentivirus particle


    Target information

    Target ID GM-MP1913
    Target Name VAMP5
    Gene ID 10791, 53620, 695471, 89818, 101091101, 482823, 540406, 100067283
    Gene Symbol and Synonyms Camp,VAMP5
    Uniprot Accession O95183
    Uniprot Entry Name VAMP5_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000168899
    Target Classification Not Available

    Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. The VAMP5 gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.