Human LEFTY2/EBAF/LEFTA ORF/cDNA clone-Lentivirus plasmid (NM_003240)

Cat. No.: pGMLP000602
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LEFTY2/EBAF/LEFTA Lentiviral expression plasmid for LEFTY2 lentivirus packaging, LEFTY2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to LEFTY2/EBAF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $608.28
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000602
Gene Name LEFTY2
Accession Number NM_003240
Gene ID 7044
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1101 bp
Gene Alias EBAF,LEFTA,LEFTYA,TGFB4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGGCCCCTGTGGCTCTGCTGGGCACTCTGGGTGCTGCCCCTGGCTGGCCCCGGGGCGGCCCTGACCGAGGAGCAGCTCCTGGGCAGCCTGCTGCGGCAGCTGCAGCTCAGCGAGGTGCCCGTACTGGACAGGGCCGACATGGAGAAGCTGGTCATCCCCGCCCACGTGAGGGCCCAGTATGTAGTCCTGCTGCGGCGCAGCCACGGGGACCGCTCCCGCGGAAAGAGGTTCAGCCAGAGCTTCCGAGAGGTGGCCGGCAGGTTCCTGGCGTCGGAGGCCAGCACACACCTGCTGGTGTTCGGCATGGAGCAGCGGCTGCCGCCCAACAGCGAGCTGGTGCAGGCCGTGCTGCGGCTCTTCCAGGAGCCGGTCCCCAAGGCCGCGCTGCACAGGCACGGGCGGCTGTCCCCGCGCAGCGCCCAGGCCCGGGTGACCGTCGAGTGGCTGCGCGTCCGCGACGACGGCTCCAACCGCACCTCCCTCATCGACTCCAGGCTGGTGTCCGTCCACGAGAGCGGCTGGAAGGCCTTCGACGTGACCGAGGCCGTGAACTTCTGGCAGCAGCTGAGCCGGCCCCGGCAGCCGCTGCTGCTACAGGTGTCGGTGCAGAGGGAGCATCTGGGCCCGCTGGCGTCCGGCGCCCACAAGCTGGTCCGCTTTGCCTCGCAGGGGGCGCCAGCCGGGCTTGGGGAGCCCCAGCTGGAGCTGCACACCCTGGACCTCAGGGACTATGGAGCTCAGGGCGACTGTGACCCTGAAGCACCAATGACCGAGGGCACCCGCTGCTGCCGCCAGGAGATGTACATTGACCTGCAGGGGATGAAGTGGGCCAAGAACTGGGTGCTGGAGCCCCCGGGCTTCCTGGCTTACGAGTGTGTGGGCACCTGCCAGCAGCCCCCGGAGGCCCTGGCCTTCAATTGGCCATTTCTGGGGCCGCGACAGTGTATCGCCTCGGAGACTGCCTCGCTGCCCATGATCGTCAGCATCAAGGAGGGAGGCAGGACCAGGCCCCAGGTGGTCAGCCTGCCCAACATGAGGGTGCAGAAGTGCAGCTGTGCCTCGGATGGGGCGCTCGTGCCAAGGAGGCTCCAGCCATAG
ORF Protein Sequence MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1068-Ab Anti-LFTY2/ LEFTY2/ EBAF functional antibody
    Target Antigen GM-Tg-g-SE1068-Ag LEFTY2 protein
    ORF Viral Vector pGMLP000602 Human LEFTY2 Lentivirus plasmid
    ORF Viral Vector vGMLP000602 Human LEFTY2 Lentivirus particle


    Target information

    Target ID GM-SE1068
    Target Name LEFTY2
    Gene ID 7044, 320202
    Gene Symbol and Synonyms 6030463A22Rik,EBAF,LEFTA,Leftb,lefty-2,lefty-B,LEFTY2,LEFTYA,TGFB4
    Uniprot Accession O00292
    Uniprot Entry Name LFTY2_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000143768
    Target Classification Not Available

    This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in this gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of this gene in the endometrium. This gene is closely linked to both a related family member and a related pseudogene. This gene encodes multiple isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Aug 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.