Human LEFTY2/EBAF/LEFTA ORF/cDNA clone-Lentivirus particle (NM_003240)
Cat. No.: vGMLP000602
Pre-made Human LEFTY2/EBAF/LEFTA Lentiviral expression plasmid for LEFTY2 lentivirus packaging, LEFTY2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
LEFTY2/EBAF products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000602 | Human LEFTY2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000602 |
| Gene Name | LEFTY2 |
| Accession Number | NM_003240 |
| Gene ID | 7044 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 1101 bp |
| Gene Alias | EBAF,LEFTA,LEFTYA,TGFB4 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTGGCCCCTGTGGCTCTGCTGGGCACTCTGGGTGCTGCCCCTGGCTGGCCCCGGGGCGGCCCTGACCGAGGAGCAGCTCCTGGGCAGCCTGCTGCGGCAGCTGCAGCTCAGCGAGGTGCCCGTACTGGACAGGGCCGACATGGAGAAGCTGGTCATCCCCGCCCACGTGAGGGCCCAGTATGTAGTCCTGCTGCGGCGCAGCCACGGGGACCGCTCCCGCGGAAAGAGGTTCAGCCAGAGCTTCCGAGAGGTGGCCGGCAGGTTCCTGGCGTCGGAGGCCAGCACACACCTGCTGGTGTTCGGCATGGAGCAGCGGCTGCCGCCCAACAGCGAGCTGGTGCAGGCCGTGCTGCGGCTCTTCCAGGAGCCGGTCCCCAAGGCCGCGCTGCACAGGCACGGGCGGCTGTCCCCGCGCAGCGCCCAGGCCCGGGTGACCGTCGAGTGGCTGCGCGTCCGCGACGACGGCTCCAACCGCACCTCCCTCATCGACTCCAGGCTGGTGTCCGTCCACGAGAGCGGCTGGAAGGCCTTCGACGTGACCGAGGCCGTGAACTTCTGGCAGCAGCTGAGCCGGCCCCGGCAGCCGCTGCTGCTACAGGTGTCGGTGCAGAGGGAGCATCTGGGCCCGCTGGCGTCCGGCGCCCACAAGCTGGTCCGCTTTGCCTCGCAGGGGGCGCCAGCCGGGCTTGGGGAGCCCCAGCTGGAGCTGCACACCCTGGACCTCAGGGACTATGGAGCTCAGGGCGACTGTGACCCTGAAGCACCAATGACCGAGGGCACCCGCTGCTGCCGCCAGGAGATGTACATTGACCTGCAGGGGATGAAGTGGGCCAAGAACTGGGTGCTGGAGCCCCCGGGCTTCCTGGCTTACGAGTGTGTGGGCACCTGCCAGCAGCCCCCGGAGGCCCTGGCCTTCAATTGGCCATTTCTGGGGCCGCGACAGTGTATCGCCTCGGAGACTGCCTCGCTGCCCATGATCGTCAGCATCAAGGAGGGAGGCAGGACCAGGCCCCAGGTGGTCAGCCTGCCCAACATGAGGGTGCAGAAGTGCAGCTGTGCCTCGGATGGGGCGCTCGTGCCAAGGAGGCTCCAGCCATAG |
| ORF Protein Sequence | MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1068-Ab | Anti-LFTY2/ LEFTY2/ EBAF functional antibody |
| Target Antigen | GM-Tg-g-SE1068-Ag | LEFTY2 protein |
| ORF Viral Vector | pGMLP000602 | Human LEFTY2 Lentivirus plasmid |
| ORF Viral Vector | vGMLP000602 | Human LEFTY2 Lentivirus particle |
Target information
| Target ID | GM-SE1068 |
| Target Name | LEFTY2 |
| Gene ID | 7044, 320202 |
| Gene Symbol and Synonyms | 6030463A22Rik,EBAF,LEFTA,Leftb,lefty-2,lefty-B,LEFTY2,LEFTYA,TGFB4 |
| Uniprot Accession | O00292 |
| Uniprot Entry Name | LFTY2_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000143768 |
| Target Classification | Not Available |
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in this gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of this gene in the endometrium. This gene is closely linked to both a related family member and a related pseudogene. This gene encodes multiple isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Aug 2016]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


