Human EMP2/XMP ORF/cDNA clone-Lentivirus plasmid (NM_001424)

Cat. No.: pGMLP000850
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human EMP2/XMP Lentiviral expression plasmid for EMP2 lentivirus packaging, EMP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to EMP2/XMP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $426
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000850
Gene Name EMP2
Accession Number NM_001424
Gene ID 2013
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 504 bp
Gene Alias XMP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTGGTGCTTCTTGCTTTCATCATCGCCTTCCACATCACCTCTGCAGCCTTGCTGTTCATTGCCACCGTCGACAATGCCTGGTGGGTAGGAGATGAGTTTTTTGCAGATGTCTGGAGAATATGTACCAACAACACGAATTGCACAGTCATCAATGACAGCTTTCAAGAGTACTCCACGCTGCAGGCGGTCCAGGCCACCATGATCCTCTCCACCATTCTCTGCTGCATCGCCTTCTTCATCTTCGTGCTCCAGCTCTTCCGCCTGAAGCAGGGAGAGAGGTTTGTCCTAACCTCCATCATCCAGCTAATGTCATGTCTGTGTGTCATGATTGCGGCCTCCATTTATACAGACAGGCGTGAAGACATTCACGACAAAAACGCGAAATTCTATCCCGTGACCAGAGAAGGCAGCTACGGCTACTCCTACATCCTGGCGTGGGTGGCCTTCGCCTGCACCTTCATCAGCGGCATGATGTACCTGATACTGAGGAAGCGCAAATAG
ORF Protein Sequence MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYSTLQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAFACTFISGMMYLILRKRK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0404-Ab Anti-EMP2/ XMP monoclonal antibody
    Target Antigen GM-Tg-g-MP0404-Ag EMP2 VLP (virus-like particle)
    ORF Viral Vector pGMLP000850 Human EMP2 Lentivirus plasmid
    ORF Viral Vector vGMLP000850 Human EMP2 Lentivirus particle


    Target information

    Target ID GM-MP0404
    Target Name EMP2
    Gene ID 2013, 13731, 710315, 360468, 101085593, 490010, 507667, 100051255
    Gene Symbol and Synonyms EMP-2,EMP2,XMP
    Uniprot Accession P54851
    Uniprot Entry Name EMP2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000213853
    Target Classification Not Available

    This gene encodes a tetraspan protein of the PMP22/EMP family. The encoded protein regulates cell membrane composition. It has been associated with various functions including endocytosis, cell signaling, cell proliferation, cell migration, cell adhesion, cell death, cholesterol homeostasis, urinary albumin excretion, and embryo implantation. It is known to negatively regulate caveolin-1, a scaffolding protein which is the main component of the caveolae plasma membrane invaginations found in most cell types. Through activation of PTK2 it positively regulates vascular endothelial growth factor A. It also modulates the function of specific integrin isomers in the plasma membrane. Up-regulation of this gene has been linked to cancer progression in multiple different tissues. Mutations in this gene have been associated with nephrotic syndrome type 10 (NPHS10). [provided by RefSeq, Mar 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.