Human KCNE2/ATFB4/LQT5 ORF/cDNA clone-Lentivirus plasmid (NM_172201)

Cat. No.: pGMLP000905
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human KCNE2/ATFB4/LQT5 Lentiviral expression plasmid for KCNE2 lentivirus packaging, KCNE2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to KCNE2/ATFB4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000905
Gene Name KCNE2
Accession Number NM_172201
Gene ID 9992
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 372 bp
Gene Alias ATFB4,LQT5,LQT6,MIRP1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTACTTTATCCAATTTCACACAGACGCTGGAAGACGTCTTCCGAAGGATTTTTATTACTTATATGGACAATTGGCGCCAGAACACAACAGCTGAGCAAGAGGCCCTCCAAGCCAAAGTTGATGCTGAGAACTTCTACTATGTCATCCTGTACCTCATGGTGATGATTGGAATGTTCTCTTTCATCATCGTGGCCATCCTGGTGAGCACTGTGAAATCCAAGAGACGGGAACACTCCAATGACCCCTACCACCAGTACATTGTAGAGGACTGGCAGGAAAAGTACAAGAGCCAAATCTTGAATCTAGAAGAATCGAAGGCCACCATCCATGAGAACATTGGTGCGGCTGGGTTCAAAATGTCCCCCTGA
ORF Protein Sequence MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0656-Ab Anti-KCNE2/ ATFB4/ LQT5 monoclonal antibody
    Target Antigen GM-Tg-g-MP0656-Ag KCNE2 VLP (virus-like particle)
    ORF Viral Vector pGMLP000905 Human KCNE2 Lentivirus plasmid
    ORF Viral Vector vGMLP000905 Human KCNE2 Lentivirus particle


    Target information

    Target ID GM-MP0656
    Target Name KCNE2
    Gene ID 9992, 246133, 171138, 101086335, 403471, 768025, 100062720
    Gene Symbol and Synonyms 2200002I16Rik,ATFB4,KCNE2,LQT5,LQT6,MIRP1
    Uniprot Accession Q9Y6J6
    Uniprot Entry Name KCNE2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000159197
    Target Classification Not Available

    Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.