Human EI24/EPG4/PIG8 ORF/cDNA clone-Lentivirus plasmid (NM_004879)
Cat. No.: pGMLP001492
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human EI24/EPG4/PIG8 Lentiviral expression plasmid for EI24 lentivirus packaging, EI24 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
EI24/EPG4 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP001492 |
Gene Name | EI24 |
Accession Number | NM_004879 |
Gene ID | 9538 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1023 bp |
Gene Alias | EPG4,PIG8,TP53I8 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCTGACAGTGTCAAAACCTTTCTCCAGGACCTTGCCAGAGGAATCAAAGACTCCATCTGGGGTATTTGTACCATCTCAAAGCTAGATGCTCGAATCCAGCAAAAGAGAGAGGAGCAGCGTCGAAGAAGGGCAAGTAGTGTCTTGGCACAGAGAAGAGCCCAGAGTATAGAGCGGAAGCAAGAGAGTGAGCCACGTATTGTTAGTAGAATTTTCCAGTGTTGTGCTTGGAATGGTGGAGTGTTCTGGTTCAGTCTCCTCTTGTTTTATCGAGTATTTATTCCTGTGCTTCAGTCGGTAACAGCCCGAATTATCGGTGACCCATCACTACATGGAGATGTTTGGTCGTGGCTGGAATTCTTCCTCACGTCAATTTTCAGTGCTCTTTGGGTGCTCCCCTTGTTTGTGCTTAGCAAAGTGGTGAATGCCATTTGGTTTCAGGATATAGCTGACCTGGCATTTGAGGTATCAGGGAGGAAGCCTCACCCATTCCCTAGTGTCAGCAAAATAATTGCTGACATGCTCTTCAACCTTTTGCTGCAGGCTCTTTTCCTCATTCAGGGAATGTTTGTGAGTCTCTTTCCCATCCATCTTGTCGGTCAGCTGGTTAGTCTCCTGCATATGTCCCTTCTCTACTCACTGTACTGCTTTGAATATCGTTGGTTCAATAAAGGAATTGAAATGCACCAGCGGTTGTCTAACATAGAAAGGAATTGGCCTTACTACTTTGGGTTTGGTTTGCCCTTGGCTTTTCTCACAGCAATGCAGTCCTCATATATTATCAGTGGCTGCCTTTTCTCTATCCTCTTTCCTTTATTCATTATCAGCGCCAATGAAGCAAAGACCCCTGGCAAAGCATATCTCTTCCAGTTGCGCCTCTTCTCCTTGGTGGTCTTCTTAAGCAACAGACTCTTCCACAAGACAGTCTACCTGCAGTCGGCCCTGAGCAGCTCTACTTCTGCAGAGAAGTTCCCTTCACCGCATCCGTCGCCTGCCAAACTGAAGGCTACTGCAGGTCACTGA |
ORF Protein Sequence | MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRIFQCCAWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEFFLTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQGMFVSLFPIHLVGQLVSLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATAGH |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP0742-Ab | Anti-EI24 monoclonal antibody |
Target Antigen | GM-Tg-g-IP0742-Ag | EI24 protein |
ORF Viral Vector | pGMLP001492 | Human EI24 Lentivirus plasmid |
ORF Viral Vector | pGMLP-atg-015 | Human EI24 Lentivirus plasmid |
ORF Viral Vector | pGMAP-atg-069 | Human EI24 Adenovirus plasmid |
ORF Viral Vector | vGMLP001492 | Human EI24 Lentivirus particle |
ORF Viral Vector | vGMLP-atg-015 | Human EI24 Lentivirus particle |
ORF Viral Vector | vGMAP-atg-069 | Human EI24 Adenovirus particle |
Target information
Target ID | GM-IP0742 |
Target Name | EI24 |
Gene ID | 9538, 13663, 713226, 300514, 101082849, 489301, 532527, 100064327 |
Gene Symbol and Synonyms | EI24,EPG4,PIG8,TP53I8 |
Uniprot Accession | O14681 |
Uniprot Entry Name | EI24_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000149547 |
Target Classification | Not Available |
This gene encodes a putative tumor suppressor and has higher expression in p53-expressing cells than in control cells and is an immediate-early induction target of p53-mediated apoptosis. The encoded protein may suppress cell growth by inducing apoptotic cell death through the caspase 9 and mitochondrial pathways. This gene is located on human chromosome 11q24, a region frequently altered in cancers. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 1, 3, 7, and 8. [provided by RefSeq, Feb 2014]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.