Human EI24/EPG4/PIG8 ORF/cDNA clone-Adenovirus particle (NM_004879)

Cat. No.: vGMAP-atg-069

Pre-made Human EI24/EPG4/PIG8 Adenovirus for EI24 overexpression in-vitro and in-vivo. The EI24 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified EI24-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to EI24/EPG4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP-atg-069 Human EI24 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP-atg-069
Gene Name EI24
Accession Number NM_004879
Gene ID 9538
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 1023 bp
Gene Alias EPG4,PIG8,TP53I8
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGACAGTGTCAAAACCTTTCTCCAGGACCTTGCCAGAGGAATCAAAGACTCCATCTGGGGTATTTGTACCATCTCAAAGCTAGATGCTCGAATCCAGCAAAAGAGAGAGGAGCAGCGTCGAAGAAGGGCAAGTAGTGTCTTGGCACAGAGAAGAGCCCAGAGTATAGAGCGGAAGCAAGAGAGTGAGCCACGTATTGTTAGTAGAATTTTCCAGTGTTGTGCTTGGAATGGTGGAGTGTTCTGGTTCAGTCTCCTCTTGTTTTATCGAGTATTTATTCCTGTGCTTCAGTCGGTAACAGCCCGAATTATCGGTGACCCATCACTACATGGAGATGTTTGGTCGTGGCTGGAATTCTTCCTCACGTCAATTTTCAGTGCTCTTTGGGTGCTCCCCTTGTTTGTGCTTAGCAAAGTGGTGAATGCCATTTGGTTTCAGGATATAGCTGACCTGGCATTTGAGGTATCAGGGAGGAAGCCTCACCCATTCCCTAGTGTCAGCAAAATAATTGCTGACATGCTCTTCAACCTTTTGCTGCAGGCTCTTTTCCTCATTCAGGGAATGTTTGTGAGTCTCTTTCCCATCCATCTTGTCGGTCAGCTGGTTAGTCTCCTGCATATGTCCCTTCTCTACTCACTGTACTGCTTTGAATATCGTTGGTTCAATAAAGGAATTGAAATGCACCAGCGGTTGTCTAACATAGAAAGGAATTGGCCTTACTACTTTGGGTTTGGTTTGCCCTTGGCTTTTCTCACAGCAATGCAGTCCTCATATATTATCAGTGGCTGCCTTTTCTCTATCCTCTTTCCTTTATTCATTATCAGCGCCAATGAAGCAAAGACCCCTGGCAAAGCATATCTCTTCCAGTTGCGCCTCTTCTCCTTGGTGGTCTTCTTAAGCAACAGACTCTTCCACAAGACAGTCTACCTGCAGTCGGCCCTGAGCAGCTCTACTTCTGCAGAGAAGTTCCCTTCACCGCATCCGTCGCCTGCCAAACTGAAGGCTACTGCAGGTCACTGA
ORF Protein Sequence MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRIFQCCAWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEFFLTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQGMFVSLFPIHLVGQLVSLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATAGH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0742-Ab Anti-EI24 monoclonal antibody
    Target Antigen GM-Tg-g-IP0742-Ag EI24 protein
    ORF Viral Vector pGMLP001492 Human EI24 Lentivirus plasmid
    ORF Viral Vector pGMLP-atg-015 Human EI24 Lentivirus plasmid
    ORF Viral Vector pGMAP-atg-069 Human EI24 Adenovirus plasmid
    ORF Viral Vector vGMLP001492 Human EI24 Lentivirus particle
    ORF Viral Vector vGMLP-atg-015 Human EI24 Lentivirus particle
    ORF Viral Vector vGMAP-atg-069 Human EI24 Adenovirus particle


    Target information

    Target ID GM-IP0742
    Target Name EI24
    Gene ID 9538, 13663, 713226, 300514, 101082849, 489301, 532527, 100064327
    Gene Symbol and Synonyms EI24,EPG4,PIG8,TP53I8
    Uniprot Accession O14681
    Uniprot Entry Name EI24_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000149547
    Target Classification Not Available

    This gene encodes a putative tumor suppressor and has higher expression in p53-expressing cells than in control cells and is an immediate-early induction target of p53-mediated apoptosis. The encoded protein may suppress cell growth by inducing apoptotic cell death through the caspase 9 and mitochondrial pathways. This gene is located on human chromosome 11q24, a region frequently altered in cancers. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 1, 3, 7, and 8. [provided by RefSeq, Feb 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.