Human GPR143/NYS6/OA1 ORF/cDNA clone-Lentivirus plasmid (NM_000273)

Cat. No.: pGMLP001778
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GPR143/NYS6/OA1 Lentiviral expression plasmid for GPR143 lentivirus packaging, GPR143 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to GPR143/NYS6 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $640.2
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001778
Gene Name GPR143
Accession Number NM_000273
Gene ID 4935
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1215 bp
Gene Alias NYS6,OA1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCTCCCCGCGCCTAGGGACCTTCTGCTGCCCCACGCGGGACGCAGCCACGCAGCTCGTGCTGAGCTTCCAGCCGCGGGCCTTCCACGCGCTCTGCCTGGGCAGCGGCGGGCTCCGCTTGGCGCTGGGCCTTCTGCAGCTGCTGCCCGGCCGCCGGCCCGCGGGCCCCGGGTCCCCCGCGACGTCCCCGCCGGCCTCGGTCCGCATCCTGCGCGCTGCCGCTGCCTGCGACCTTCTCGGCTGCCTGGGTATGGTGATCCGGTCCACCGTGTGGTTAGGATTCCCAAATTTTGTTGACAGCGTCTCGGATATGAACCACACGGAAATTTGGCCTGCTGCTTTCTGCGTGGGGAGTGCGATGTGGATCCAGCTGTTGTACAGTGCCTGCTTCTGGTGGCTGTTTTGCTATGCAGTGGATGCTTATCTGGTGATCCGGAGATCGGCAGGACTGAGCACCATCCTGCTGTATCACATCATGGCGTGGGGCCTGGCCACCCTGCTCTGTGTGGAGGGAGCCGCCATGCTCTACTACCCTTCCGTGTCCAGGTGTGAGCGGGGCCTGGACCACGCCATCCCCCACTATGTCACCATGTACCTGCCCCTGCTGCTGGTTCTCGTGGCGAACCCCATCCTGTTCCAAAAGACAGTGACTGCAGTGGCCTCTTTACTTAAAGGAAGACAAGGCATTTACACGGAGAACGAGAGGAGGATGGGAGCCGTGATCAAGATCCGATTTTTCAAAATCATGCTGGTTTTAATTATTTGTTGGTTGTCGAATATCATCAATGAAAGCCTTTTATTCTATCTTGAGATGCAAACAGATATCAATGGAGGTTCTTTGAAACCTGTCAGAACTGCAGCCAAGACCACATGGTTTATTATGGGAATCCTGAATCCAGCCCAGGGATTTCTCTTGTCTTTGGCCTTCTACGGCTGGACAGGATGCAGCCTGGGTTTTCAGTCTCCCAGGAAGGAGATCCAGTGGGAATCACTGACCACCTCGGCTGCTGAGGGGGCTCACCCATCCCCACTGATGCCCCATGAAAACCCTGCTTCCGGGAAGGTGTCTCAAGTGGGTGGGCAGACTTCTGACGAAGCCCTGAGCATGCTGTCTGAAGGTTCTGATGCCAGCACAATTGAAATTCACACTGCAAGTGAATCCTGCAACAAAAATGAGGGTGACCCTGCTCTCCCAACCCATGGAGACCTATGA
ORF Protein Sequence MASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSPATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSAMWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPSVSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGAVIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNPAQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0510-Ab Anti-GP143/ GPR143/ NYS6 monoclonal antibody
    Target Antigen GM-Tg-g-MP0510-Ag GPR143 VLP (virus-like particle)
    ORF Viral Vector pGMLP001778 Human GPR143 Lentivirus plasmid
    ORF Viral Vector vGMLP001778 Human GPR143 Lentivirus particle


    Target information

    Target ID GM-MP0510
    Target Name GPR143
    Gene ID 4935, 18241, 709148, 302619, 101087044, 491733, 613505, 100147328
    Gene Symbol and Synonyms GPR143,NYS6,OA1,RGD1565799
    Uniprot Accession P51810
    Uniprot Entry Name GP143_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000101850
    Target Classification GPCR

    This gene encodes a protein that binds to heterotrimeric G proteins and is targeted to melanosomes in pigment cells. This protein is thought to be involved in intracellular signal transduction mechanisms. Mutations in this gene cause ocular albinism type 1, also referred to as Nettleship-Falls type ocular albinism, a severe visual disorder. A related pseudogene has been identified on chromosome Y. [provided by RefSeq, Dec 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.