Human ASPH/AAH/BAH ORF/cDNA clone-Lentivirus plasmid (NM_001164756)

Cat. No.: pGMLP002035
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ASPH/AAH/BAH Lentiviral expression plasmid for ASPH lentivirus packaging, ASPH lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to ASPH/AAH products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $453
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002035
Gene Name ASPH
Accession Number NM_001164756
Gene ID 444
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 612 bp
Gene Alias AAH,BAH,CASQ2BP1,FDLAB,HAAH,JCTN,junctin
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCAGCGTAAGAATGCCAAGAGCAGCGGCAACAGCAGCAGCAGCGGCTCCGGCAGCGGTAGCACGAGTGCGGGCAGCAGCAGCCCCGGGGCCCGGAGAGAGACAAAGCATGGAGGACACAAGAATGGGAGGAAAGGCGGACTCTCAGGAACTTCATTCTTCACGTGGTTTATGGTGATTGCATTGCTGGGCGTCTGGACATCTGTAGCTGTCGTTTGGTTTGATCTTGTTGACTATGAGGAAGTTCTAGCCAAAGCAAAGGACTTCCGTTATAACTTATCAGAGGTGCTTCAAGGAAAACTAGGAATCTATGATGCTGATGGTGATGGAGATTTTGATGTGGATGATGCCAAAGTTTTATTAGGCCTGACCAAAGATGGCAGTAATGAAAATATTGATTCTCTTGAGGAAGTCCTTAATATTTTAGCAGAGGAAAGTTCAGATTGGTTTTATGGTTTCCTCTCATTTCTCTATGATATAATGACTCCTTTTGAAATGCTAGAAGAAGAAGAAGAAGAAAGCGAAACCGCAGATGGTGTTGATGGTACGTCACAGAATGAAGGGGTTCAGGGAAAGACTTGTGTCATATTGGATTTACATAACCAGTAA
ORF Protein Sequence MAQRKNAKSSGNSSSSGSGSGSTSAGSSSPGARRETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLAKAKDFRYNLSEVLQGKLGIYDADGDGDFDVDDAKVLLGLTKDGSNENIDSLEEVLNILAEESSDWFYGFLSFLYDIMTPFEMLEEEEEESETADGVDGTSQNEGVQGKTCVILDLHNQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T52133-Ab Anti-ASPH/ AAH/ BAH monoclonal antibody
    Target Antigen GM-Tg-g-T52133-Ag ASPH VLP (virus-like particle)
    ORF Viral Vector pGMLP002035 Human ASPH Lentivirus plasmid
    ORF Viral Vector vGMLP002035 Human ASPH Lentivirus particle


    Target information

    Target ID GM-T52133
    Target Name ASPH
    Gene ID 444, 65973, 699884, 312981, 105260207, 403846, 286771, 100065909
    Gene Symbol and Synonyms 2310005F16Rik,3110001L23Rik,AAH,ASPH,BAH,CASQ2BP1,cI-37,FDLAB,HAAH,JCTN,junctin
    Uniprot Accession Q12797
    Uniprot Entry Name ASPH_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease Not Available
    Gene Ensembl ENSG00000198363
    Target Classification Checkpoint-Immuno Oncology

    This gene is thought to play an important role in calcium homeostasis. The gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis. [provided by RefSeq, Sep 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.