Human ASPH/AAH/BAH ORF/cDNA clone-Lentivirus particle (NM_001164756)
Cat. No.: vGMLP002035
Pre-made Human ASPH/AAH/BAH Lentiviral expression plasmid for ASPH lentivirus packaging, ASPH lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
ASPH/AAH products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP002035 | Human ASPH Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP002035 |
| Gene Name | ASPH |
| Accession Number | NM_001164756 |
| Gene ID | 444 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 612 bp |
| Gene Alias | AAH,BAH,CASQ2BP1,FDLAB,HAAH,JCTN,junctin |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCCCAGCGTAAGAATGCCAAGAGCAGCGGCAACAGCAGCAGCAGCGGCTCCGGCAGCGGTAGCACGAGTGCGGGCAGCAGCAGCCCCGGGGCCCGGAGAGAGACAAAGCATGGAGGACACAAGAATGGGAGGAAAGGCGGACTCTCAGGAACTTCATTCTTCACGTGGTTTATGGTGATTGCATTGCTGGGCGTCTGGACATCTGTAGCTGTCGTTTGGTTTGATCTTGTTGACTATGAGGAAGTTCTAGCCAAAGCAAAGGACTTCCGTTATAACTTATCAGAGGTGCTTCAAGGAAAACTAGGAATCTATGATGCTGATGGTGATGGAGATTTTGATGTGGATGATGCCAAAGTTTTATTAGGCCTGACCAAAGATGGCAGTAATGAAAATATTGATTCTCTTGAGGAAGTCCTTAATATTTTAGCAGAGGAAAGTTCAGATTGGTTTTATGGTTTCCTCTCATTTCTCTATGATATAATGACTCCTTTTGAAATGCTAGAAGAAGAAGAAGAAGAAAGCGAAACCGCAGATGGTGTTGATGGTACGTCACAGAATGAAGGGGTTCAGGGAAAGACTTGTGTCATATTGGATTTACATAACCAGTAA |
| ORF Protein Sequence | MAQRKNAKSSGNSSSSGSGSGSTSAGSSSPGARRETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLAKAKDFRYNLSEVLQGKLGIYDADGDGDFDVDDAKVLLGLTKDGSNENIDSLEEVLNILAEESSDWFYGFLSFLYDIMTPFEMLEEEEEESETADGVDGTSQNEGVQGKTCVILDLHNQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T52133-Ab | Anti-ASPH/ AAH/ BAH monoclonal antibody |
| Target Antigen | GM-Tg-g-T52133-Ag | ASPH VLP (virus-like particle) |
| ORF Viral Vector | pGMLP002035 | Human ASPH Lentivirus plasmid |
| ORF Viral Vector | vGMLP002035 | Human ASPH Lentivirus particle |
Target information
| Target ID | GM-T52133 |
| Target Name | ASPH |
| Gene ID | 444, 65973, 699884, 312981, 105260207, 403846, 286771, 100065909 |
| Gene Symbol and Synonyms | 2310005F16Rik,3110001L23Rik,AAH,ASPH,BAH,CASQ2BP1,cI-37,FDLAB,HAAH,JCTN,junctin |
| Uniprot Accession | Q12797 |
| Uniprot Entry Name | ASPH_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Immuno-oncology Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000198363 |
| Target Classification | Checkpoint-Immuno Oncology |
This gene is thought to play an important role in calcium homeostasis. The gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis. [provided by RefSeq, Sep 2009]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


