Human RASD1/AGS1/DEXRAS1 ORF/cDNA clone-Lentivirus plasmid (NM_016084.4)

Cat. No.: pGMLP002248
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RASD1/AGS1/DEXRAS1 Lentiviral expression plasmid for RASD1 lentivirus packaging, RASD1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RASD1/AGS1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $511.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002248
Gene Name RASD1
Accession Number NM_016084.4
Gene ID 51655
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 846 bp
Gene Alias AGS1,DEXRAS1,MGC:26290
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAACTGGCCGCGATGATCAAGAAGATGTGCCCGAGCGACTCGGAGCTGAGTATCCCGGCCAAGAACTGCTATCGCATGGTCATCCTCGGCTCGTCCAAGGTGGGCAAGACGGCCATCGTGTCGCGCTTCCTCACCGGCCGCTTCGAGGACGCCTACACGCCTACCATCGAGGACTTCCACCGCAAGTTCTACTCCATCCGCGGCGAGGTCTACCAGCTCGACATCCTCGACACGTCCGGCAACCACCCGTTCCCCGCCATGCGGCGCCTCTCCATCCTCACAGGAGACGTTTTCATCCTGGTGTTCAGTCTGGACAACCGCGACTCCTTCGAGGAGGTGCAGCGGCTCAGGCAGCAGATCCTCGACACCAAGTCTTGCCTCAAGAACAAAACCAAGGAGAACGTGGACGTGCCCCTGGTCATCTGCGGCAACAAGGGTGACCGCGACTTCTACCGCGAGGTGGACCAGCGCGAGATCGAGCAGCTGGTGGGCGACGACCCCCAGCGCTGCGCCTACTTCGAGATCTCGGCCAAGAAGAACAGCAGCCTGGACCAGATGTTCCGCGCGCTCTTCGCCATGGCCAAGCTGCCCAGCGAGATGAGCCCAGACCTGCACCGCAAGGTCTCGGTGCAGTACTGCGACGTGCTGCACAAGAAGGCGCTGCGGAACAAGAAGCTGCTGCGGGCCGGCAGCGGCGGCGGCGGCGGCGACCCGGGCGACGCCTTTGGCATCGTGGCACCCTTCGCGCGCCGGCCCAGCGTACACAGCGACCTCATGTACATCCGCGAGAAGGCCAGCGCCGGCAGCCAGGCCAAGGACAAGGAGCGCTGCGTCATCAGCTAG
ORF Protein Sequence MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGGDPGDAFGIVAPFARRPSVHSDLMYIREKASAGSQAKDKERCVIS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2284-Ab Anti-RASD1/ AGS1/ DEXRAS1 monoclonal antibody
    Target Antigen GM-Tg-g-MP2284-Ag RASD1 VLP (virus-like particle)
    ORF Viral Vector pGMLP002248 Human RASD1 Lentivirus plasmid
    ORF Viral Vector vGMLP002248 Human RASD1 Lentivirus particle


    Target information

    Target ID GM-MP2284
    Target Name RASD1
    Gene ID 51655, 19416, 698839, 64455, 101080588, 489542, 507449, 100146638
    Gene Symbol and Synonyms AGS1,DEXRAS1,MGC:26290,RASD1
    Uniprot Accession Q9Y272
    Uniprot Entry Name RASD1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000108551
    Target Classification Not Available

    This gene encodes a member of the Ras superfamily of small GTPases and is induced by dexamethasone. The encoded protein is an activator of G-protein signaling and acts as a direct nucleotide exchange factor for Gi-Go proteins. This protein interacts with the neuronal nitric oxide adaptor protein CAPON, and a nuclear adaptor protein FE65, which interacts with the Alzheimer's disease amyloid precursor protein. This gene may play a role in dexamethasone-induced alterations in cell morphology, growth and cell-extracellular matrix interactions. Epigenetic inactivation of this gene is closely correlated with resistance to dexamethasone in multiple myeloma cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.