Human RASD1/AGS1/DEXRAS1 ORF/cDNA clone-Lentivirus plasmid (NM_016084.4)
Cat. No.: pGMLP002248
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human RASD1/AGS1/DEXRAS1 Lentiviral expression plasmid for RASD1 lentivirus packaging, RASD1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
RASD1/AGS1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP002248 |
Gene Name | RASD1 |
Accession Number | NM_016084.4 |
Gene ID | 51655 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 846 bp |
Gene Alias | AGS1,DEXRAS1,MGC:26290 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAAACTGGCCGCGATGATCAAGAAGATGTGCCCGAGCGACTCGGAGCTGAGTATCCCGGCCAAGAACTGCTATCGCATGGTCATCCTCGGCTCGTCCAAGGTGGGCAAGACGGCCATCGTGTCGCGCTTCCTCACCGGCCGCTTCGAGGACGCCTACACGCCTACCATCGAGGACTTCCACCGCAAGTTCTACTCCATCCGCGGCGAGGTCTACCAGCTCGACATCCTCGACACGTCCGGCAACCACCCGTTCCCCGCCATGCGGCGCCTCTCCATCCTCACAGGAGACGTTTTCATCCTGGTGTTCAGTCTGGACAACCGCGACTCCTTCGAGGAGGTGCAGCGGCTCAGGCAGCAGATCCTCGACACCAAGTCTTGCCTCAAGAACAAAACCAAGGAGAACGTGGACGTGCCCCTGGTCATCTGCGGCAACAAGGGTGACCGCGACTTCTACCGCGAGGTGGACCAGCGCGAGATCGAGCAGCTGGTGGGCGACGACCCCCAGCGCTGCGCCTACTTCGAGATCTCGGCCAAGAAGAACAGCAGCCTGGACCAGATGTTCCGCGCGCTCTTCGCCATGGCCAAGCTGCCCAGCGAGATGAGCCCAGACCTGCACCGCAAGGTCTCGGTGCAGTACTGCGACGTGCTGCACAAGAAGGCGCTGCGGAACAAGAAGCTGCTGCGGGCCGGCAGCGGCGGCGGCGGCGGCGACCCGGGCGACGCCTTTGGCATCGTGGCACCCTTCGCGCGCCGGCCCAGCGTACACAGCGACCTCATGTACATCCGCGAGAAGGCCAGCGCCGGCAGCCAGGCCAAGGACAAGGAGCGCTGCGTCATCAGCTAG |
ORF Protein Sequence | MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGGDPGDAFGIVAPFARRPSVHSDLMYIREKASAGSQAKDKERCVIS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP2284-Ab | Anti-RASD1/ AGS1/ DEXRAS1 monoclonal antibody |
Target Antigen | GM-Tg-g-MP2284-Ag | RASD1 VLP (virus-like particle) |
ORF Viral Vector | pGMLP002248 | Human RASD1 Lentivirus plasmid |
ORF Viral Vector | vGMLP002248 | Human RASD1 Lentivirus particle |
Target information
Target ID | GM-MP2284 |
Target Name | RASD1 |
Gene ID | 51655, 19416, 698839, 64455, 101080588, 489542, 507449, 100146638 |
Gene Symbol and Synonyms | AGS1,DEXRAS1,MGC:26290,RASD1 |
Uniprot Accession | Q9Y272 |
Uniprot Entry Name | RASD1_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000108551 |
Target Classification | Not Available |
This gene encodes a member of the Ras superfamily of small GTPases and is induced by dexamethasone. The encoded protein is an activator of G-protein signaling and acts as a direct nucleotide exchange factor for Gi-Go proteins. This protein interacts with the neuronal nitric oxide adaptor protein CAPON, and a nuclear adaptor protein FE65, which interacts with the Alzheimer's disease amyloid precursor protein. This gene may play a role in dexamethasone-induced alterations in cell morphology, growth and cell-extracellular matrix interactions. Epigenetic inactivation of this gene is closely correlated with resistance to dexamethasone in multiple myeloma cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2011]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.