Human SCAMP1/SCAMP/SCAMP37 ORF/cDNA clone-Lentivirus plasmid (NM_004866)

Cat. No.: pGMLP002525
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SCAMP1/SCAMP/SCAMP37 Lentiviral expression plasmid for SCAMP1 lentivirus packaging, SCAMP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SCAMP1/SCAMP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $584.76
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002525
Gene Name SCAMP1
Accession Number NM_004866
Gene ID 9522
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1017 bp
Gene Alias SCAMP,SCAMP37
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCGGATTTCGACAGTAACCCGTTTGCCGACCCGGATCTCAACAATCCCTTCAAGGATCCATCAGTTACACAAGTGACAAGAAATGTTCCACCAGGACTTGATGAATATAATCCATTCTCGGATTCTAGAACACCTCCACCAGGCGGTGTGAAGATGCCTAATGTACCCAATACACAACCAGCAATAATGAAACCAACAGAGGAACATCCAGCTTATACACAGATTGCAAAGGAACATGCATTGGCCCAAGCTGAACTTCTTAAGCGCCAGGAAGAACTAGAAAGAAAAGCCGCAGAATTAGATCGTCGGGAACGAGAAATGCAAAACCTCAGTCAACATGGTAGAAAAAATAATTGGCCACCTCTTCCTAGCAATTTTCCTGTCGGACCTTGTTTCTATCAGGATTTTTCTGTAGACATTCCTGTAGAATTCCAAAAGACAGTAAAGCTTATGTACTACTTGTGGATGTTCCATGCAGTAACACTGTTTCTAAATATCTTCGGATGCTTGGCTTGGTTTTGTGTTGATTCTGCAAGAGCGGTTGATTTTGGATTGAGTATCCTGTGGTTCTTGCTTTTTACTCCTTGTTCATTTGTCTGTTGGTACAGACCACTTTATGGAGCTTTCAGGAGTGACAGTTCATTTAGATTCTTTGTATTCTTCTTCGTCTATATTTGTCAGTTTGCTGTACATGTACTCCAAGCTGCAGGATTTCATAACTGGGGCAATTGTGGTTGGATTTCATCCCTTACTGGTCTCAACCAAAATATTCCTGTTGGAATCATGATGATAATCATAGCAGCACTTTTCACAGCATCAGCAGTCATCTCACTAGTTATGTTCAAAAAAGTACATGGACTATATCGCACAACAGGTGCTAGTTTTGAGAAGGCCCAACAGGAGTTTGCAACAGGTGTGATGTCCAACAAAACTGTCCAGACCGCAGCTGCAAATGCAGCTTCAACTGCAGCATCTAGTGCAGCTCAGAATGCTTTCAAGGGTAACCAGATTTAA
ORF Protein Sequence MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSARAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSNKTVQTAAANAASTAASSAAQNAFKGNQI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1481-Ab Anti-SCAM1/ SCAMP1/ SCAMP monoclonal antibody
    Target Antigen GM-Tg-g-MP1481-Ag SCAMP1 VLP (virus-like particle)
    ORF Viral Vector pGMLP002525 Human SCAMP1 Lentivirus plasmid
    ORF Viral Vector vGMLP002525 Human SCAMP1 Lentivirus particle


    Target information

    Target ID GM-MP1481
    Target Name SCAMP1
    Gene ID 9522, 107767, 100424165, 29521, 101080863, 479172, 535352, 100073271
    Gene Symbol and Synonyms 4930505M11Rik,SCAMP,SCAMP1,SCAMP37
    Uniprot Accession O15126
    Uniprot Entry Name SCAM1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000085365
    Target Classification Not Available

    This gene product belongs to the SCAMP family of proteins, which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that these protein family members may function at the same site during vesicular transport rather than in separate pathways. A pseudogene of this gene has been defined on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.