Human CD151/GP27/MER2 ORF/cDNA clone-Lentivirus plasmid (NM_139029)

Cat. No.: pGMLP002731
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD151/GP27/MER2 Lentiviral expression plasmid for CD151 lentivirus packaging, CD151 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CD151/GP27 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $490.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002731
Gene Name CD151
Accession Number NM_139029
Gene ID 977
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 762 bp
Gene Alias GP27,MER2,PETA-3,RAPH,SFA1,TSPAN24
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGTGAGTTCAACGAGAAGAAGACAACATGTGGCACCGTTTGCCTCAAGTACCTGCTGTTTACCTACAATTGCTGCTTCTGGCTGGCTGGCCTGGCTGTCATGGCAGTGGGCATCTGGACGCTGGCCCTCAAGAGTGACTACATCAGCCTGCTGGCCTCAGGCACCTACCTGGCCACAGCCTACATCCTGGTGGTGGCGGGCACTGTCGTCATGGTGACTGGGGTCTTGGGCTGCTGCGCCACCTTCAAGGAGCGTCGGAACCTGCTGCGCCTGTACTTCATCCTGCTCCTCATCATCTTTCTGCTGGAGATCATCGCTGGTATCCTCGCCTACGCCTACTACCAGCAGCTGAACACGGAGCTCAAGGAGAACCTGAAGGACACCATGACCAAGCGCTACCACCAGCCGGGCCATGAGGCTGTGACCAGCGCTGTGGACCAGCTGCAGCAGGAGTTCCACTGCTGTGGCAGCAACAACTCACAGGACTGGCGAGACAGTGAGTGGATCCGCTCACAGGAGGCCGGTGGCCGTGTGGTCCCAGACAGCTGCTGCAAGACGGTGGTGGCTCTTTGTGGGCAGCGAGACCATGCCTCCAACATCTACAAGGTGGAGGGCGGCTGCATCACCAAGTTGGAGACCTTCATCCAGGAGCACCTGAGGGTCATTGGGGCTGTGGGGATCGGCATTGCCTGTGTGCAGGTCTTTGGCATGATCTTCACGTGCTGCCTGTACAGGAGTCTCAAGCTGGAGCACTACTGA
ORF Protein Sequence MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0194-Ab Anti-CD151/ GP27/ MER2 monoclonal antibody
    Target Antigen GM-Tg-g-MP0194-Ag CD151 VLP (virus-like particle)
    ORF Viral Vector pGMLP002731 Human CD151 Lentivirus plasmid
    ORF Viral Vector vGMLP002731 Human CD151 Lentivirus particle


    Target information

    Target ID GM-MP0194
    Target Name CD151
    Gene ID 977, 12476, 574139, 64315, 101098337, 475992, 523328, 100056151
    Gene Symbol and Synonyms CD151,EBS7,GP27,MER2,PETA-3,RAPH,SFA-1,SFA1,TSPAN24
    Uniprot Accession P48509
    Uniprot Entry Name CD151_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000177697
    Target Classification Not Available

    The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein have been described for this gene. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.