Human CD151/GP27/MER2 ORF/cDNA clone-Lentivirus particle (NM_139029)
Cat. No.: vGMLP002731
Pre-made Human CD151/GP27/MER2 Lentiviral expression plasmid for CD151 lentivirus packaging, CD151 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CD151/GP27 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP002731 | Human CD151 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP002731 |
| Gene Name | CD151 |
| Accession Number | NM_139029 |
| Gene ID | 977 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 762 bp |
| Gene Alias | GP27,MER2,PETA-3,RAPH,SFA1,TSPAN24 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGGTGAGTTCAACGAGAAGAAGACAACATGTGGCACCGTTTGCCTCAAGTACCTGCTGTTTACCTACAATTGCTGCTTCTGGCTGGCTGGCCTGGCTGTCATGGCAGTGGGCATCTGGACGCTGGCCCTCAAGAGTGACTACATCAGCCTGCTGGCCTCAGGCACCTACCTGGCCACAGCCTACATCCTGGTGGTGGCGGGCACTGTCGTCATGGTGACTGGGGTCTTGGGCTGCTGCGCCACCTTCAAGGAGCGTCGGAACCTGCTGCGCCTGTACTTCATCCTGCTCCTCATCATCTTTCTGCTGGAGATCATCGCTGGTATCCTCGCCTACGCCTACTACCAGCAGCTGAACACGGAGCTCAAGGAGAACCTGAAGGACACCATGACCAAGCGCTACCACCAGCCGGGCCATGAGGCTGTGACCAGCGCTGTGGACCAGCTGCAGCAGGAGTTCCACTGCTGTGGCAGCAACAACTCACAGGACTGGCGAGACAGTGAGTGGATCCGCTCACAGGAGGCCGGTGGCCGTGTGGTCCCAGACAGCTGCTGCAAGACGGTGGTGGCTCTTTGTGGGCAGCGAGACCATGCCTCCAACATCTACAAGGTGGAGGGCGGCTGCATCACCAAGTTGGAGACCTTCATCCAGGAGCACCTGAGGGTCATTGGGGCTGTGGGGATCGGCATTGCCTGTGTGCAGGTCTTTGGCATGATCTTCACGTGCTGCCTGTACAGGAGTCTCAAGCTGGAGCACTACTGA |
| ORF Protein Sequence | MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP0194-Ab | Anti-CD151/ GP27/ MER2 monoclonal antibody |
| Target Antigen | GM-Tg-g-MP0194-Ag | CD151 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP002731 | Human CD151 Lentivirus plasmid |
| ORF Viral Vector | vGMLP002731 | Human CD151 Lentivirus particle |
Target information
| Target ID | GM-MP0194 |
| Target Name | CD151 |
| Gene ID | 977, 12476, 574139, 64315, 101098337, 475992, 523328, 100056151 |
| Gene Symbol and Synonyms | CD151,EBS7,GP27,MER2,PETA-3,RAPH,SFA-1,SFA1,TSPAN24 |
| Uniprot Accession | P48509 |
| Uniprot Entry Name | CD151_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000177697 |
| Target Classification | Not Available |
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein have been described for this gene. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


