Human RAPSN/CMS11/CMS4C ORF/cDNA clone-Lentivirus plasmid (NM_032645)

Cat. No.: pGMLP002983
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RAPSN/CMS11/CMS4C Lentiviral expression plasmid for RAPSN lentivirus packaging, RAPSN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RAPSN/CMS11 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $597.36
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002983
Gene Name RAPSN
Accession Number NM_032645
Gene ID 5913
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1062 bp
Gene Alias CMS11,CMS4C,FADS,RAPSYN,RNF205
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGCAGGACCAGACCAAGCAGCAGATCGAGAAGGGGCTCCAGCTGTACCAGTCCAACCAGACAGAGAAGGCATTGCAGGTGTGGACAAAGGTGCTGGAGAAGAGCTCGGACCTCATGGGGCGCTTCCGCGTGCTGGGCTGCCTGGTCACAGCCCACTCGGAGATGGGCCGCTACAAGGAGATGCTGAAGTTCGCTGTGGTCCAGATCGACACGGCCCGGGAGCTGGAGGATGCCGACTTCCTCCTGGAGAGCTACCTGAACCTGGCACGCAGCAACGAGAAGCTGTGCGAGTTTCACAAGACCATCTCCTACTGCAAGACCTGCCTTGGGCTGCCTGGTACCAGGGCAGGTGCCCAGCTCGGAGGCCAGGTCAGCCTGAGCATGGGCAATGCCTTCCTGGGCCTCAGCGTCTTCCAGAAGGCCCTGGAGAGCTTCGAGAAGGCCCTGCGCTATGCCCACAACAATGATGACGCCATGCTCGAGTGCCGCGTGTGCTGCAGCCTGGGCAGCTTCTATGCCCAGGTCAAGGACTACGAGAAAGCCCTGTTCTTCCCCTGCAAGGCGGCAGAGCTTGTCAACAACTATGGCAAAGGCTGGAGCCTGAAGTACCGGGCCATGAGCCAGTACCACATGGCCGTGGCCTATCGCCTGCTGGGCCGCCTGGGCAGTGCCATGGAGTGTTGTGAGGAGTCTATGAAGATCGCGCTGCAGCACGGGGACCGGCCACTGCAGGCGCTCTGCCTGCTCTGCTTCGCTGACATCCACCGGAGCCGTGGGGACCTGGAGCTGAGCCAGCTCAAGCTGCACTGTCTGAGCGAGAGCATTTACCGCAGCAAAGGGCTGCAGCGGGAACTGCGGGCGCACGTTGTGAGGTTCCACGAGTGCGTGGAGGAGACGGAGCTCTACTGCGGCCTGTGCGGCGAGTCCATAGGCGAGAAGAACAGCCGGCTGCAGGCCCTACCTTGCTCCCACATCTTCCACCTCAGGTGCCTGCAGAACAACGGGACCCGGAGCTGTCCCAACTGCCGCCGCTCATCCATGAAGCCTGGCTTTGTATGA
ORF Protein Sequence MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLVTAHSEMGRYKEMLKFAVVQIDTARELEDADFLLESYLNLARSNEKLCEFHKTISYCKTCLGLPGTRAGAQLGGQVSLSMGNAFLGLSVFQKALESFEKALRYAHNNDDAMLECRVCCSLGSFYAQVKDYEKALFFPCKAAELVNNYGKGWSLKYRAMSQYHMAVAYRLLGRLGSAMECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLELSQLKLHCLSESIYRSKGLQRELRAHVVRFHECVEETELYCGLCGESIGEKNSRLQALPCSHIFHLRCLQNNGTRSCPNCRRSSMKPGFV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2281-Ab Anti-RAPSN/ CMS11/ CMS4C monoclonal antibody
    Target Antigen GM-Tg-g-MP2281-Ag RAPSN VLP (virus-like particle)
    ORF Viral Vector pGMLP002983 Human RAPSN Lentivirus plasmid
    ORF Viral Vector pGMLV002315 Human RAPSN Lentivirus plasmid
    ORF Viral Vector vGMLP002983 Human RAPSN Lentivirus particle
    ORF Viral Vector vGMLV002315 Human RAPSN Lentivirus particle


    Target information

    Target ID GM-MP2281
    Target Name RAPSN
    Gene ID 5913, 19400, 711689, 362161, 101095679, 609725, 541061, 100051540
    Gene Symbol and Synonyms 43kDa,CMS11,CMS4C,FADS,FADS2,Nraps,Raps,RAPSN,RAPSYN,RNF205
    Uniprot Accession Q13702
    Uniprot Entry Name RAPSN_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000165917
    Target Classification Not Available

    This gene encodes a member of a family of proteins that are receptor associated proteins of the synapse. The encoded protein contains a conserved cAMP-dependent protein kinase phosphorylation site, and plays a critical role in clustering and anchoring nicotinic acetylcholine receptors at synaptic sites by linking the receptors to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin. Mutations in this gene may play a role in postsynaptic congenital myasthenic syndromes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Apr 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.