Human INSL3/ley-I-L/RLF ORF/cDNA clone-Lentivirus plasmid (NM_005543)

Cat. No.: pGMLP003337
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human INSL3/ley-I-L/RLF Lentiviral expression plasmid for INSL3 lentivirus packaging, INSL3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to INSL3/ley-I-L products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003337
Gene Name INSL3
Accession Number NM_005543
Gene ID 3640
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 396 bp
Gene Alias ley-I-L,RLF,RLNL
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACCCCCGTCTGCCCGCCTGGGCGCTGGTGCTGCTGGGCCCTGCCCTGGTGTTCGCGTTGGGCCCCGCGCCCACCCCAGAGATGCGTGAGAAGTTGTGCGGCCACCACTTCGTACGCGCGCTAGTGCGCGTGTGCGGGGGCCCCCGCTGGTCCACCGAAGCCAGGAGGCCTGCGACCGGAGGCGACCGTGAGTTGCTACAGTGGCTGGAGAGACGACATCTGCTCCATGGGCTGGTGGCCGACAGTAATCTCACGCTGGGACCTGGCCTGCAGCCCCTGCCCCAGACCTCTCACCATCACCGCCACCACCGTGCAGCTGCCACCAACCCTGCACGCTACTGCTGCCTCAGTGGCTGTACCCAACAAGACCTGCTGACCCTCTGTCCCTACTGA
ORF Protein Sequence MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1034-Ab Anti-INSL3/ RLF/ RLNL functional antibody
    Target Antigen GM-Tg-g-SE1034-Ag INSL3 protein
    ORF Viral Vector pGMLP003337 Human INSL3 Lentivirus plasmid
    ORF Viral Vector vGMLP003337 Human INSL3 Lentivirus particle


    Target information

    Target ID GM-SE1034
    Target Name INSL3
    Gene ID 3640, 16336, 100533194, 114215, 101084860, 403436, 281870, 100146149
    Gene Symbol and Synonyms INSL3,ley-I-L,RLF,RLNL
    Uniprot Accession P51460
    Uniprot Entry Name INSL3_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000248099
    Target Classification Not Available

    This gene encodes a member of the insulin-like hormone superfamily. The encoded protein is mainly produced in gonadal tissues. Studies of the mouse counterpart suggest that this gene may be involved in the development of urogenital tract and female fertility. This protein may also act as a hormone to regulate growth and differentiation of gubernaculum, and thus mediating intra-abdominal testicular descent. Mutations in this gene may lead to cryptorchidism. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.