Human INSL3/ley-I-L/RLF ORF/cDNA clone-Lentivirus particle (NM_005543)
Cat. No.: vGMLP003337
Pre-made Human INSL3/ley-I-L/RLF Lentiviral expression plasmid for INSL3 lentivirus packaging, INSL3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
INSL3/ley-I-L products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP003337 | Human INSL3 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP003337 |
Gene Name | INSL3 |
Accession Number | NM_005543 |
Gene ID | 3640 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 396 bp |
Gene Alias | ley-I-L,RLF,RLNL |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGACCCCCGTCTGCCCGCCTGGGCGCTGGTGCTGCTGGGCCCTGCCCTGGTGTTCGCGTTGGGCCCCGCGCCCACCCCAGAGATGCGTGAGAAGTTGTGCGGCCACCACTTCGTACGCGCGCTAGTGCGCGTGTGCGGGGGCCCCCGCTGGTCCACCGAAGCCAGGAGGCCTGCGACCGGAGGCGACCGTGAGTTGCTACAGTGGCTGGAGAGACGACATCTGCTCCATGGGCTGGTGGCCGACAGTAATCTCACGCTGGGACCTGGCCTGCAGCCCCTGCCCCAGACCTCTCACCATCACCGCCACCACCGTGCAGCTGCCACCAACCCTGCACGCTACTGCTGCCTCAGTGGCTGTACCCAACAAGACCTGCTGACCCTCTGTCCCTACTGA |
ORF Protein Sequence | MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE1034-Ab | Anti-INSL3/ RLF/ RLNL functional antibody |
Target Antigen | GM-Tg-g-SE1034-Ag | INSL3 protein |
ORF Viral Vector | pGMLP003337 | Human INSL3 Lentivirus plasmid |
ORF Viral Vector | vGMLP003337 | Human INSL3 Lentivirus particle |
Target information
Target ID | GM-SE1034 |
Target Name | INSL3 |
Gene ID | 3640, 16336, 100533194, 114215, 101084860, 403436, 281870, 100146149 |
Gene Symbol and Synonyms | INSL3,ley-I-L,RLF,RLNL |
Uniprot Accession | P51460 |
Uniprot Entry Name | INSL3_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000248099 |
Target Classification | Not Available |
This gene encodes a member of the insulin-like hormone superfamily. The encoded protein is mainly produced in gonadal tissues. Studies of the mouse counterpart suggest that this gene may be involved in the development of urogenital tract and female fertility. This protein may also act as a hormone to regulate growth and differentiation of gubernaculum, and thus mediating intra-abdominal testicular descent. Mutations in this gene may lead to cryptorchidism. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2012]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.