Human GYPA/CD235a/GPA ORF/cDNA clone-Lentivirus plasmid (NM_001308190)

Cat. No.: pGMLP003338
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GYPA/CD235a/GPA Lentiviral expression plasmid for GYPA lentivirus packaging, GYPA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to GYPA/CD235a products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003338
Gene Name GYPA
Accession Number NM_001308190
Gene ID 2993
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 354 bp
Gene Alias CD235a,GPA,GPErik,GPSAT,HGpMiV,HGpMiXI,HGpSta(C),MN,MNS,PAS-2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTATGGAAAAATAATCTTTGTATTACTATTGTCAGATACGCACAAACGGGACACATATGCAGCCACTCCTAGAGCTCATGAAGTTTCAGAAATTTCTGTTAGAACTGTTTACCCTCCAGAAGAGGAAACCGGAGAAAGGGTACAACTTGCCCATCATTTCTCTGAACCAGAGATAACACTCATTATTTTTGGGGTGATGGCTGGTGTTATTGGAACGATCCTCTTAATTTCTTACGGTATTCGCCGACTGATAAAGAAAAGCCCATCTGATGTAAAACCTCTCCCCTCACCTGACACAGACGTGCCTTTAAGTTCTGTTGAAATAGAAAATCCAGAGACAAGTGATCAATGA
ORF Protein Sequence MYGKIIFVLLLSDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0565-Ab Anti-GLPA/ GYPA/ CD235a monoclonal antibody
    Target Antigen GM-Tg-g-MP0565-Ag GYPA VLP (virus-like particle)
    ORF Viral Vector pGMLP003338 Human GYPA Lentivirus plasmid
    ORF Viral Vector vGMLP003338 Human GYPA Lentivirus particle


    Target information

    Target ID GM-MP0565
    Target Name GYPA
    Gene ID 2993, 574101, 688972, 109498956, 617836, 102150508
    Gene Symbol and Synonyms CD235a,GPA,GPErik,GPSAT,GYPA,HGpMiV,HGpMiXI,HGpSta(C),MN,MNS,PAS-2
    Uniprot Accession P02724
    Uniprot Entry Name GLPA_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000170180
    Target Classification Not Available

    Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. In addition to the M or N and S or s antigens that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta, as well as Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.