Human S100A9/60B8AG/CAGB ORF/cDNA clone-Lentivirus plasmid (NM_002965)

Cat. No.: pGMLP003387
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human S100A9/60B8AG/CAGB Lentiviral expression plasmid for S100A9 lentivirus packaging, S100A9 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to S100A9/60B8AG products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003387
Gene Name S100A9
Accession Number NM_002965
Gene ID 6280
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 345 bp
Gene Alias 60B8AG,CAGB,CFAG,CGLB,L1AG,LIAG,MAC387,MIF,MRP14,NIF,P14
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACTTGCAAAATGTCGCAGCTGGAACGCAACATAGAGACCATCATCAACACCTTCCACCAATACTCTGTGAAGCTGGGGCACCCAGACACCCTGAACCAGGGGGAATTCAAAGAGCTGGTGCGAAAAGATCTGCAAAATTTTCTCAAGAAGGAGAATAAGAATGAAAAGGTCATAGAACACATCATGGAGGACCTGGACACAAATGCAGACAAGCAGCTGAGCTTCGAGGAGTTCATCATGCTGATGGCGAGGCTAACCTGGGCCTCCCACGAGAAGATGCACGAGGGTGACGAGGGCCCTGGCCACCACCATAAGCCAGGCCTCGGGGAGGGCACCCCCTAA
ORF Protein Sequence MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T38431-Ab Anti-S10A9/ S100A9/ 60B8AG monoclonal antibody
    Target Antigen GM-Tg-g-T38431-Ag S100A9 VLP (virus-like particle)
    ORF Viral Vector pGMLP003387 Human S100A9 Lentivirus plasmid
    ORF Viral Vector pGMPC000118 Human S100a9 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC000398 Human S100A9 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001206 Human S100A9 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP003387 Human S100A9 Lentivirus particle


    Target information

    Target ID GM-T38431
    Target Name S100A9
    Gene ID 6280, 20202, 714690, 94195, 101084419, 490463, 532569, 100061730
    Gene Symbol and Synonyms 60B8AG,BEE22,CAGB,CFAG,CGLB,GAGB,L1AG,LIAG,MAC387,MIF,MRP14,NIF,P14,S100-A9,S100A9
    Uniprot Accession P06702
    Uniprot Entry Name S10A9_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Diagnostics Biomarker
    Disease Glucose intolerance, Congenital occlusion of ureteropelvic junction, Gastrointestinal system cancer, Diabetic Nephropathy, Liver cell carcinoma, Perinatal necrotizing enterocolitis
    Gene Ensembl ENSG00000163220
    Target Classification Not Available

    The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity. [provided by RefSeq, Nov 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.