Human S100A9/60B8AG/CAGB ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_002965.4)
Cat. No.: pGMPC000398
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human S100A9/60B8AG/CAGB Non-Viral expression plasmid (overexpression vector) for mouse S100A9 overexpression in unique cell transient transfection and stable cell line development.
Go to
S100A9/60B8AG products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMPC000398 |
Gene Name | S100A9 |
Accession Number | NM_002965.4 |
Gene ID | 6280 |
Species | Human |
Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
Insert Length | 345 bp |
Gene Alias | 60B8AG,CAGB,CFAG,CGLB,L1AG,LIAG,MAC387,MIF,MRP14,NIF,P14 |
Fluorescent Reporter | EGFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGACTTGCAAAATGTCGCAGCTGGAACGCAACATAGAGACCATCATCAACACCTTCCACCAATACTCTGTGAAGCTGGGGCACCCAGACACCCTGAACCAGGGGGAATTCAAAGAGCTGGTGCGAAAAGATCTGCAAAATTTTCTCAAGAAGGAGAATAAGAATGAAAAGGTCATAGAACACATCATGGAGGACCTGGACACAAATGCAGACAAGCAGCTGAGCTTCGAGGAGTTCATCATGCTGATGGCGAGGCTAACCTGGGCCTCCCACGAGAAGATGCACGAGGGTGACGAGGGCCCTGGCCACCACCATAAGCCAGGCCTCGGGGAGGGCACCCCCTAA |
ORF Protein Sequence | MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T38431-Ab | Anti-S10A9/ S100A9/ 60B8AG monoclonal antibody |
Target Antigen | GM-Tg-g-T38431-Ag | S100A9 VLP (virus-like particle) |
ORF Viral Vector | pGMLP003387 | Human S100A9 Lentivirus plasmid |
ORF Viral Vector | pGMPC000118 | Human S100a9 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC000398 | Human S100A9 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC001206 | Human S100A9 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP003387 | Human S100A9 Lentivirus particle |
Target information
Target ID | GM-T38431 |
Target Name | S100A9 |
Gene ID | 6280, 20202, 714690, 94195, 101084419, 490463, 532569, 100061730 |
Gene Symbol and Synonyms | 60B8AG,BEE22,CAGB,CFAG,CGLB,GAGB,L1AG,LIAG,MAC387,MIF,MRP14,NIF,P14,S100-A9,S100A9 |
Uniprot Accession | P06702 |
Uniprot Entry Name | S10A9_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target, Diagnostics Biomarker |
Disease | Glucose intolerance, Congenital occlusion of ureteropelvic junction, Gastrointestinal system cancer, Diabetic Nephropathy, Liver cell carcinoma, Perinatal necrotizing enterocolitis |
Gene Ensembl | ENSG00000163220 |
Target Classification | Not Available |
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity. [provided by RefSeq, Nov 2014]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.