Human UBA52/CEP52/HUBCEP52 ORF/cDNA clone-Lentivirus plasmid (NM_001033930)

Cat. No.: pGMLP003398
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human UBA52/CEP52/HUBCEP52 Lentiviral expression plasmid for UBA52 lentivirus packaging, UBA52 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to UBA52/CEP52 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003398
Gene Name UBA52
Accession Number NM_001033930
Gene ID 7311
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 387 bp
Gene Alias CEP52,HUBCEP52,L40,RPL40
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGATCTTTGTGAAGACCCTCACTGGCAAAACCATCACCCTTGAGGTCGAGCCCAGTGACACCATTGAGAATGTCAAAGCCAAAATTCAAGACAAGGAGGGTATCCCACCTGACCAGCAGCGTCTGATATTTGCCGGCAAACAGCTGGAGGATGGCCGCACTCTCTCAGACTACAACATCCAGAAAGAGTCCACCCTGCACCTGGTGTTGCGCCTGCGAGGTGGCATTATTGAGCCTTCTCTCCGCCAGCTTGCCCAGAAATACAACTGCGACAAGATGATCTGCCGCAAGTGCTATGCTCGCCTTCACCCTCGTGCTGTCAACTGCCGCAAGAAGAAGTGTGGTCACACCAACAACCTGCGTCCCAAGAAGAAGGTCAAATAA
ORF Protein Sequence MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNNLRPKKKVK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2368-Ab Anti-RL40/ UBA52/ CEP52 monoclonal antibody
    Target Antigen GM-Tg-g-MP2368-Ag UBA52 VLP (virus-like particle)
    ORF Viral Vector pGMLP003398 Human UBA52 Lentivirus plasmid
    ORF Viral Vector vGMLP003398 Human UBA52 Lentivirus particle


    Target information

    Target ID GM-MP2368
    Target Name UBA52
    Gene ID 7311, 22186, 720243, 64156, 100144608, 403722, 615199, 100071005
    Gene Symbol and Synonyms CEP52,D8Ertd21e,Gm1863,HUBCEP52,L40,RPL40,Rps27a,UB-RPL40,UBA52,Ubb,Ubc,UBCEP2
    Uniprot Accession P62987
    Uniprot Entry Name RL40_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Lung Cancer, Diabetic Nephropathy
    Gene Ensembl ENSG00000221983
    Target Classification Not Available

    Ubiquitin is a highly conserved nuclear and cytoplasmic protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome. It is also involved in the maintenance of chromatin structure, the regulation of gene expression, and the stress response. Ubiquitin is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin moiety fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein L40 at the C terminus, a C-terminal extension protein (CEP). Multiple processed pseudogenes derived from this gene are present in the genome. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.