Human SDC2/CD362/HSPG ORF/cDNA clone-Lentivirus plasmid (NM_002998)

Cat. No.: pGMLP003440
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SDC2/CD362/HSPG Lentiviral expression plasmid for SDC2 lentivirus packaging, SDC2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SDC2/CD362 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $451.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003440
Gene Name SDC2
Accession Number NM_002998
Gene ID 6383
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 606 bp
Gene Alias CD362,HSPG,HSPG1,SYND2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGGCGCGCGTGGATCCTGCTCACCTTGGGCTTGGTGGCCTGCGTGTCGGCGGAGTCGAGAGCAGAGCTGACATCTGATAAAGACATGTACCTTGACAACAGCTCCATTGAAGAAGCTTCAGGAGTGTATCCTATTGATGACGATGACTACGCTTCTGCGTCTGGCTCGGGAGCTGATGAGGATGTAGAGAGTCCAGAGCTGACAACATCTCGACCACTTCCAAAGATACTGTTGACTAGTGCTGCTCCAAAAGTGGAAACCACGACGCTGAATATACAGAACAAGATACCTGCTCAGACAAAGTCACCTGAAGAAACTGATAAAGAGAAAGTTCACCTCTCTGACTCAGAAAGGAAAATGGACCCAGCCGAAGAGGATACAAATGTGTATACTGAGAAACACTCAGACAGTCTGTTTAAACGGACAGAAGTCCTAGCAGCTGTCATTGCTGGTGGAGTTATTGGCTTTCTCTTTGCAATTTTTCTTATCCTGCTGTTGGTGTATCGCATGAGAAAGAAGGATGAAGGAAGCTATGACCTTGGAGAACGCAAACCATCCAGTGCTGCTTATCAGAAGGCACCTACTAAGGAGTTTTATGCGTAA
ORF Protein Sequence MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T80848-Ab Anti-SDC2/ CD362/ HSPG monoclonal antibody
    Target Antigen GM-Tg-g-T80848-Ag SDC2 VLP (virus-like particle)
    ORF Viral Vector pGMLP003440 Human SDC2 Lentivirus plasmid
    ORF Viral Vector vGMLP003440 Human SDC2 Lentivirus particle


    Target information

    Target ID GM-T80848
    Target Name SDC2
    Gene ID 6383, 15529, 703841, 25615, 101092416, 119866660, 615785, 100059727
    Gene Symbol and Synonyms 4833414L08Rik,CD362,HSPG,HSPG1,SDC2,SYND2,syndecan-2
    Uniprot Accession P34741
    Uniprot Entry Name SDC2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000169439
    Target Classification Not Available

    The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. The syndecan-2 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered syndecan-2 expression has been detected in several different tumor types. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.