Human SDC2/CD362/HSPG ORF/cDNA clone-Lentivirus particle (NM_002998)
Cat. No.: vGMLP003440
Pre-made Human SDC2/CD362/HSPG Lentiviral expression plasmid for SDC2 lentivirus packaging, SDC2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
SDC2/CD362 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP003440 | Human SDC2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP003440 |
| Gene Name | SDC2 |
| Accession Number | NM_002998 |
| Gene ID | 6383 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 606 bp |
| Gene Alias | CD362,HSPG,HSPG1,SYND2 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCGGCGCGCGTGGATCCTGCTCACCTTGGGCTTGGTGGCCTGCGTGTCGGCGGAGTCGAGAGCAGAGCTGACATCTGATAAAGACATGTACCTTGACAACAGCTCCATTGAAGAAGCTTCAGGAGTGTATCCTATTGATGACGATGACTACGCTTCTGCGTCTGGCTCGGGAGCTGATGAGGATGTAGAGAGTCCAGAGCTGACAACATCTCGACCACTTCCAAAGATACTGTTGACTAGTGCTGCTCCAAAAGTGGAAACCACGACGCTGAATATACAGAACAAGATACCTGCTCAGACAAAGTCACCTGAAGAAACTGATAAAGAGAAAGTTCACCTCTCTGACTCAGAAAGGAAAATGGACCCAGCCGAAGAGGATACAAATGTGTATACTGAGAAACACTCAGACAGTCTGTTTAAACGGACAGAAGTCCTAGCAGCTGTCATTGCTGGTGGAGTTATTGGCTTTCTCTTTGCAATTTTTCTTATCCTGCTGTTGGTGTATCGCATGAGAAAGAAGGATGAAGGAAGCTATGACCTTGGAGAACGCAAACCATCCAGTGCTGCTTATCAGAAGGCACCTACTAAGGAGTTTTATGCGTAA |
| ORF Protein Sequence | MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T80848-Ab | Anti-SDC2/ CD362/ HSPG monoclonal antibody |
| Target Antigen | GM-Tg-g-T80848-Ag | SDC2 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP003440 | Human SDC2 Lentivirus plasmid |
| ORF Viral Vector | vGMLP003440 | Human SDC2 Lentivirus particle |
Target information
| Target ID | GM-T80848 |
| Target Name | SDC2 |
| Gene ID | 6383, 15529, 703841, 25615, 101092416, 119866660, 615785, 100059727 |
| Gene Symbol and Synonyms | 4833414L08Rik,CD362,HSPG,HSPG1,SDC2,SYND2,syndecan-2 |
| Uniprot Accession | P34741 |
| Uniprot Entry Name | SDC2_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000169439 |
| Target Classification | Not Available |
The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. The syndecan-2 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered syndecan-2 expression has been detected in several different tumor types. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


