Human PAQR7/MPRA/mSR ORF/cDNA clone-Lentivirus plasmid (NM_178422)

Cat. No.: pGMLP003567
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PAQR7/MPRA/mSR Lentiviral expression plasmid for PAQR7 lentivirus packaging, PAQR7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PAQR7/MPRA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $591.48
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003567
Gene Name PAQR7
Accession Number NM_178422
Gene ID 164091
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1041 bp
Gene Alias MPRA,mSR,PGLP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCATGGCCCAGAAACTCAGCCACCTCCTGCCGAGTCTGCGGCAGGTCATCCAGGAGCCTCAGCTATCTCTGCAGCCAGAGCCTGTCTTCACGGTGGATCGAGCTGAGGTGCCGCCGCTCTTCTGGAAGCCGTACATCTATGCGGGCTACCGGCCGCTGCATCAGACCTGGCGCTTCTATTTCCGCACGCTGTTCCAGCAGCACAACGAGGCCGTGAATGTCTGGACCCACCTGCTGGCGGCCCTGGTACTGCTGCTGCGGCTGGCCCTCTTTGTGGAGACCGTGGACTTCTGGGGAGACCCACACGCCCTGCCCCTCTTCATCATTGTCCTTGCCTCTTTCACCTACCTCTCCTTCAGTGCCTTGGCTCACCTCCTGCAGGCCAAGTCTGAGTTCTGGCATTACAGCTTCTTCTTCCTGGACTATGTGGGGGTGGCCGTGTACCAGTTTGGCAGTGCCTTGGCACACTTCTACTATGCTATCGAGCCCGCCTGGCATGCCCAGGTGCAGGCTGTTTTTCTGCCCATGGCTGCCTTTCTCGCCTGGCTTTCCTGCATTGGCTCCTGCTATAACAAGTACATCCAGAAACCAGGCCTGCTGGGCCGCACATGCCAGGAGGTGCCCTCCGTCCTGGCCTACGCACTGGACATTAGTCCTGTGGTGCATCGTATCTTCGTGTCCTCCGACCCCACCACGGATGATCCAGCTCTTCTCTACCACAAGTGCCAGGTGGTCTTCTTTCTGCTGGCTGCTGCCTTCTTCTCTACCTTCATGCCCGAGCGCTGGTTCCCTGGCAGCTGCCATGTCTTCGGGCAGGGCCACCAACTTTTCCACATCTTCTTGGTGCTGTGCACGCTGGCTCAGCTGGAGGCTGTGGCACTGGACTATGAGGCCCGACGGCCCATCTATGAGCCTCTGCACACGCACTGGCCTCACAACTTTTCTGGCCTCTTCCTGCTCACGGTGGGCAGCAGCATCCTCACTGCATTCCTCCTGAGCCAGCTGGTACAGCGCAAACTTGATCAGAAGACCAAGTGA
ORF Protein Sequence MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQHNEAVNVWTHLLAALVLLLRLALFVETVDFWGDPHALPLFIIVLASFTYLSFSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPAWHAQVQAVFLPMAAFLAWLSCIGSCYNKYIQKPGLLGRTCQEVPSVLAYALDISPVVHRIFVSSDPTTDDPALLYHKCQVVFFLLAAAFFSTFMPERWFPGSCHVFGQGHQLFHIFLVLCTLAQLEAVALDYEARRPIYEPLHTHWPHNFSGLFLLTVGSSILTAFLLSQLVQRKLDQKTK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1317-Ab Anti-PAQR7/ MPRA/ PGLP monoclonal antibody
    Target Antigen GM-Tg-g-MP1317-Ag PAQR7 VLP (virus-like particle)
    ORF Viral Vector pGMLP003567 Human PAQR7 Lentivirus plasmid
    ORF Viral Vector vGMLP003567 Human PAQR7 Lentivirus particle


    Target information

    Target ID GM-MP1317
    Target Name PAQR7
    Gene ID 164091, 71904, 713411, 313615, 101082327, 487364, 522932, 100071257
    Gene Symbol and Synonyms 2310021M12Rik,mPR,mPR alpha,MPRA,mSR,PAQR7,PGLP
    Uniprot Accession Q86WK9
    Uniprot Entry Name PAQR7_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000182749
    Target Classification Not Available

    Predicted to enable steroid binding activity and steroid hormone receptor activity. Predicted to be involved in response to steroid hormone. Predicted to be integral component of membrane. Predicted to be active in plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.