Human REG1A/ICRF/P19 ORF/cDNA clone-Lentivirus plasmid (NM_002909)
Cat. No.: pGMLP003861
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human REG1A/ICRF/P19 Lentiviral expression plasmid for REG1A lentivirus packaging, REG1A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
REG1A/ICRF products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003861 |
Gene Name | REG1A |
Accession Number | NM_002909 |
Gene ID | 5967 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 501 bp |
Gene Alias | ICRF,P19,PSP,PSPS,PSPS1,PTP,REG |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCTCAGACCAGCTCATACTTCATGCTGATCTCCTGCCTGATGTTTCTGTCTCAGAGCCAAGGCCAAGAGGCCCAGACAGAGTTGCCCCAGGCCCGGATCAGCTGCCCAGAAGGCACCAATGCCTATCGCTCCTACTGCTACTACTTTAATGAAGACCGTGAGACCTGGGTTGATGCAGATCTCTATTGCCAGAACATGAATTCGGGCAACCTGGTGTCTGTGCTCACCCAGGCCGAGGGTGCCTTTGTGGCCTCACTGATTAAGGAGAGTGGCACTGATGACTTCAATGTCTGGATTGGCCTCCATGACCCCAAAAAGAACCGCCGCTGGCACTGGAGCAGTGGGTCCCTGGTCTCCTACAAGTCCTGGGGCATTGGAGCCCCAAGCAGTGTTAATCCTGGCTACTGTGTGAGCCTGACCTCAAGCACAGGATTCCAGAAATGGAAGGATGTGCCTTGTGAAGACAAGTTCTCCTTTGTCTGCAAGTTCAAAAACTAG |
ORF Protein Sequence | MAQTSSYFMLISCLMFLSQSQGQEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE1236-Ab | Anti-REG1A/ ICRF/ P19 functional antibody |
Target Antigen | GM-Tg-g-SE1236-Ag | REG1A protein |
ORF Viral Vector | pGMLP003861 | Human REG1A Lentivirus plasmid |
ORF Viral Vector | vGMLP003861 | Human REG1A Lentivirus particle |
Target information
Target ID | GM-SE1236 |
Target Name | REG1A |
Gene ID | 5967 |
Gene Symbol and Synonyms | ICRF,P19,PSP,PSPS,PSPS1,PTP,REG,REG1A |
Uniprot Accession | P05451 |
Uniprot Entry Name | REG1A_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Pancreas Cancer, Other obstructive and reflux uropathy, Malignant neoplasm of bladder |
Gene Ensembl | ENSG00000115386 |
Target Classification | Not Available |
This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.