Human REG1A/ICRF/P19 ORF/cDNA clone-Lentivirus particle (NM_002909)

Cat. No.: vGMLP003861

Pre-made Human REG1A/ICRF/P19 Lentiviral expression plasmid for REG1A lentivirus packaging, REG1A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to REG1A/ICRF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003861 Human REG1A Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003861
Gene Name REG1A
Accession Number NM_002909
Gene ID 5967
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 501 bp
Gene Alias ICRF,P19,PSP,PSPS,PSPS1,PTP,REG
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCAGACCAGCTCATACTTCATGCTGATCTCCTGCCTGATGTTTCTGTCTCAGAGCCAAGGCCAAGAGGCCCAGACAGAGTTGCCCCAGGCCCGGATCAGCTGCCCAGAAGGCACCAATGCCTATCGCTCCTACTGCTACTACTTTAATGAAGACCGTGAGACCTGGGTTGATGCAGATCTCTATTGCCAGAACATGAATTCGGGCAACCTGGTGTCTGTGCTCACCCAGGCCGAGGGTGCCTTTGTGGCCTCACTGATTAAGGAGAGTGGCACTGATGACTTCAATGTCTGGATTGGCCTCCATGACCCCAAAAAGAACCGCCGCTGGCACTGGAGCAGTGGGTCCCTGGTCTCCTACAAGTCCTGGGGCATTGGAGCCCCAAGCAGTGTTAATCCTGGCTACTGTGTGAGCCTGACCTCAAGCACAGGATTCCAGAAATGGAAGGATGTGCCTTGTGAAGACAAGTTCTCCTTTGTCTGCAAGTTCAAAAACTAG
ORF Protein Sequence MAQTSSYFMLISCLMFLSQSQGQEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1236-Ab Anti-REG1A/ ICRF/ P19 functional antibody
    Target Antigen GM-Tg-g-SE1236-Ag REG1A protein
    ORF Viral Vector pGMLP003861 Human REG1A Lentivirus plasmid
    ORF Viral Vector vGMLP003861 Human REG1A Lentivirus particle


    Target information

    Target ID GM-SE1236
    Target Name REG1A
    Gene ID 5967
    Gene Symbol and Synonyms ICRF,P19,PSP,PSPS,PSPS1,PTP,REG,REG1A
    Uniprot Accession P05451
    Uniprot Entry Name REG1A_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Pancreas Cancer, Other obstructive and reflux uropathy, Malignant neoplasm of bladder
    Gene Ensembl ENSG00000115386
    Target Classification Not Available

    This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.