Human LILRA3/CD85E/e3 ORF/cDNA clone-Lentivirus plasmid (BC028208)
Cat. No.: pGMLP004094
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human LILRA3/CD85E/e3 Lentiviral expression plasmid for LILRA3 lentivirus packaging, LILRA3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
LILRA3/CD85E products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004094 |
Gene Name | LILRA3 |
Accession Number | BC028208 |
Gene ID | 11026 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1320 bp |
Gene Alias | CD85E,e3,HM31,HM43,ILT6,LIR-4,LIR4 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGACCTCCATCCTCACGGTCCTGATCTGTCTCGGGCTGAGCCTGGACCCCAGGACCCACGTGCAGGCAGGGCCCCTCCCCAAGCCCACCCTCTGGGCTGAGCCAGGCTCTGTGATCACCCAAGGGAGTCCTGTGACCCTCAGGTGTCAGGGGAGCCTGGAGACGCAGGAGTACCATCTATATAGAGAAAAGAAAACAGCACTCTGGATTACACGGATCCCACAGGAGCTTGTGAAGAAGGGCCAGTTCCCCATCCTATCCATCACCTGGGAACATGCAGGGCGGTATTGCTGTATCTATGGCAGCCACACTGTAGGCCTCTCAGAGAGCAGTGACCCCCTGGAGCTGGTGGTGACAGGAGCCTACAGCAAACCCACCCTCTCAGCTCTGCCCAGCCCTGTGGTGACCTCAGGAGGGAATGTGACCATCCAGTGTGACTCACAGGTGGCATTTGATGGCTTCATTCTGTGTAAGGAAGGAGAAGATGAACACCCACAATGCCTGAACTCCCATTCCCATGCCCGTGGGTCATCCCGGGCCATCTTCTCCGTGGGCCCCGTGAGCCCAAGTCGCAGGTGGTCGTACAGGTGCTATGGTTATGACTCGCGCGCTCCCTATGTGTGGTCTCTACCCAGTGATCTCCTGGGGCTCCTGGTCCCAGGTGTTTCTAAGAAGCCATCACTCTCAGTGCAGCCGGGTCCTGTCGTGGCCCCTGGGGAGAAGCTGACCTTCCAGTGTGGCTCTGATGCCGGCTACGACAGATTTGTTCTGTACAAGGAGTGGGGACGTGACTTCCTCCAGCGCCCTGGCCGGCAGCCCCAGGCTGGGCTCTCCCAGGCCAACTTCACCCTGGGCCCTGTGAGCCGCTCCTACGGGGGCCAGTACACATGCTCCGGTGCATACAACCTCTCCTCCGAGTGGTCGGCCCCCAGCGACCCCCTGGACATCCTGATCACAGGACAGATCCGTGCCAGACCCTTCCTCTCCGTGCGGCCGGGCCCCACAGTGGCCTCAGGAGAGAACGTGACCCTGCTGTGTCAGTCACAGGGAGGGATGCACACTTTCCTTTTGACCAAGGAGGGGGCAGCTGATTCCCCGCTGCGTCTAAAATCAAAGCGCCAATCTCATAAGTACCAGGCTGAATTCCCCATGAGTCCTGTGACCTCGGCCCACGCGGGGACCTACAGGTGCTACGGCTCACTCAGCTCCAACCCCTACCTGCTGACTCACCCCAGTGACCCCCTGGAGCTCGTGGTCTCAGGAGCAGCTGAGACCCTCAGCCCACCACAAAACAAGTCCGACTCCAAGGCTGGTGAGTGA |
ORF Protein Sequence | MTSILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-TA063-Ab | Anti-LIRA3/ LILRA3/ CD85E monoclonal antibody |
Target Antigen | GM-Tg-g-TA063-Ag | LILRA3 VLP (virus-like particle) |
ORF Viral Vector | pGMLP003697 | Human LILRA3 Lentivirus plasmid |
ORF Viral Vector | pGMLP004094 | Human LILRA3 Lentivirus plasmid |
ORF Viral Vector | vGMLP003697 | Human LILRA3 Lentivirus particle |
ORF Viral Vector | vGMLP004094 | Human LILRA3 Lentivirus particle |
Target information
Target ID | GM-TA063 |
Target Name | LILRA3 |
Gene ID | 11026, 692337 |
Gene Symbol and Synonyms | CD85E,HM31,HM43,ILT-6,ILT6,LILRA3,LILRAD,LIR-4,LIR4 |
Uniprot Accession | Q8N6C8 |
Uniprot Entry Name | LIRA3_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000273884 |
Target Classification | Not Available |
This gene encodes a member of a family of immunoreceptors that are expressed predominantly in monocytes and B cells, and at lower levels in dendritic cells and natural killer cells. The encoded protein lacks the transmembrane region found in other members of this family. It acts as a soluble receptor for class I major histocompatibility complex (MHC) antigens. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and is polymorphic in human populations, with many individuals containing a deletion of this genomic region. [provided by RefSeq, Mar 2014]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.