Human LILRA3/CD85E/e3 ORF/cDNA clone-Lentivirus plasmid (BC028208)

Cat. No.: pGMLP004094
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LILRA3/CD85E/e3 Lentiviral expression plasmid for LILRA3 lentivirus packaging, LILRA3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to LILRA3/CD85E products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $669.6
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004094
Gene Name LILRA3
Accession Number BC028208
Gene ID 11026
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1320 bp
Gene Alias CD85E,e3,HM31,HM43,ILT6,LIR-4,LIR4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACCTCCATCCTCACGGTCCTGATCTGTCTCGGGCTGAGCCTGGACCCCAGGACCCACGTGCAGGCAGGGCCCCTCCCCAAGCCCACCCTCTGGGCTGAGCCAGGCTCTGTGATCACCCAAGGGAGTCCTGTGACCCTCAGGTGTCAGGGGAGCCTGGAGACGCAGGAGTACCATCTATATAGAGAAAAGAAAACAGCACTCTGGATTACACGGATCCCACAGGAGCTTGTGAAGAAGGGCCAGTTCCCCATCCTATCCATCACCTGGGAACATGCAGGGCGGTATTGCTGTATCTATGGCAGCCACACTGTAGGCCTCTCAGAGAGCAGTGACCCCCTGGAGCTGGTGGTGACAGGAGCCTACAGCAAACCCACCCTCTCAGCTCTGCCCAGCCCTGTGGTGACCTCAGGAGGGAATGTGACCATCCAGTGTGACTCACAGGTGGCATTTGATGGCTTCATTCTGTGTAAGGAAGGAGAAGATGAACACCCACAATGCCTGAACTCCCATTCCCATGCCCGTGGGTCATCCCGGGCCATCTTCTCCGTGGGCCCCGTGAGCCCAAGTCGCAGGTGGTCGTACAGGTGCTATGGTTATGACTCGCGCGCTCCCTATGTGTGGTCTCTACCCAGTGATCTCCTGGGGCTCCTGGTCCCAGGTGTTTCTAAGAAGCCATCACTCTCAGTGCAGCCGGGTCCTGTCGTGGCCCCTGGGGAGAAGCTGACCTTCCAGTGTGGCTCTGATGCCGGCTACGACAGATTTGTTCTGTACAAGGAGTGGGGACGTGACTTCCTCCAGCGCCCTGGCCGGCAGCCCCAGGCTGGGCTCTCCCAGGCCAACTTCACCCTGGGCCCTGTGAGCCGCTCCTACGGGGGCCAGTACACATGCTCCGGTGCATACAACCTCTCCTCCGAGTGGTCGGCCCCCAGCGACCCCCTGGACATCCTGATCACAGGACAGATCCGTGCCAGACCCTTCCTCTCCGTGCGGCCGGGCCCCACAGTGGCCTCAGGAGAGAACGTGACCCTGCTGTGTCAGTCACAGGGAGGGATGCACACTTTCCTTTTGACCAAGGAGGGGGCAGCTGATTCCCCGCTGCGTCTAAAATCAAAGCGCCAATCTCATAAGTACCAGGCTGAATTCCCCATGAGTCCTGTGACCTCGGCCCACGCGGGGACCTACAGGTGCTACGGCTCACTCAGCTCCAACCCCTACCTGCTGACTCACCCCAGTGACCCCCTGGAGCTCGTGGTCTCAGGAGCAGCTGAGACCCTCAGCCCACCACAAAACAAGTCCGACTCCAAGGCTGGTGAGTGA
ORF Protein Sequence MTSILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA063-Ab Anti-LIRA3/ LILRA3/ CD85E monoclonal antibody
    Target Antigen GM-Tg-g-TA063-Ag LILRA3 VLP (virus-like particle)
    ORF Viral Vector pGMLP003697 Human LILRA3 Lentivirus plasmid
    ORF Viral Vector pGMLP004094 Human LILRA3 Lentivirus plasmid
    ORF Viral Vector vGMLP003697 Human LILRA3 Lentivirus particle
    ORF Viral Vector vGMLP004094 Human LILRA3 Lentivirus particle


    Target information

    Target ID GM-TA063
    Target Name LILRA3
    Gene ID 11026, 692337
    Gene Symbol and Synonyms CD85E,HM31,HM43,ILT-6,ILT6,LILRA3,LILRAD,LIR-4,LIR4
    Uniprot Accession Q8N6C8
    Uniprot Entry Name LIRA3_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000273884
    Target Classification Not Available

    This gene encodes a member of a family of immunoreceptors that are expressed predominantly in monocytes and B cells, and at lower levels in dendritic cells and natural killer cells. The encoded protein lacks the transmembrane region found in other members of this family. It acts as a soluble receptor for class I major histocompatibility complex (MHC) antigens. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and is polymorphic in human populations, with many individuals containing a deletion of this genomic region. [provided by RefSeq, Mar 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.