Human LILRA3/CD85E/HM31 ORF/cDNA clone-Lentivirus particle (NM_006865)

Cat. No.: vGMLP003697

Pre-made Human LILRA3/CD85E/HM31 Lentiviral expression plasmid for LILRA3 lentivirus packaging, LILRA3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to LILRA3/CD85E products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003697 Human LILRA3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003697
Gene Name LILRA3
Accession Number NM_006865
Gene ID 11026
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 1320 bp
Gene Alias CD85E,HM31,HM43,ILT-6,ILT6,LIR-4,LIR4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACCCCCATCCTCACGGTCCTGATCTGTCTCGGGCTGAGCCTGGACCCCAGGACCCACGTGCAGGCAGGGCCCCTCCCCAAGCCCACCCTCTGGGCTGAGCCAGGCTCTGTGATCACCCAAGGGAGTCCTGTGACCCTCAGGTGTCAGGGGAGCCTGGAGACGCAGGAGTACCATCTATATAGAGAAAAGAAAACAGCACTCTGGATTACACGGATCCCACAGGAGCTTGTGAAGAAGGGCCAGTTCCCCATCCTATCCATCACCTGGGAACATGCAGGGCGGTATTGCTGTATCTATGGCAGCCACACTGCAGGCCTCTCAGAGAGCAGTGACCCCCTGGAGCTGGTGGTGACAGGAGCCTACAGCAAACCCACCCTCTCAGCTCTGCCCAGCCCTGTGGTGACCTCAGGAGGGAATGTGACCATCCAGTGTGACTCACAGGTGGCATTTGATGGCTTCATTCTGTGTAAGGAAGGAGAAGATGAACACCCACAATGCCTGAACTCCCATTCCCATGCCCGTGGGTCATCCCGGGCCATCTTCTCCGTGGGCCCCGTGAGCCCAAGTCGCAGGTGGTCGTACAGGTGCTATGGTTATGACTCGCGCGCTCCCTATGTGTGGTCTCTACCCAGTGATCTCCTGGGGCTCCTGGTCCCAGGTGTTTCTAAGAAGCCATCACTCTCAGTGCAGCCGGGTCCTGTCGTGGCCCCTGGGGAGAAGCTGACCTTCCAGTGTGGCTCTGATGCCGGCTACGACAGATTTGTTCTGTACAAGGAGTGGGGACGTGACTTCCTCCAGCGCCCTGGCCGGCAGCCCCAGGCTGGGCTCTCCCAGGCCAACTTCACCCTGGGCCCTGTGAGCCGCTCCTACGGGGGCCAGTACACATGCTCCGGTGCATACAACCTCTCCTCCGAGTGGTCGGCCCCCAGCGACCCCCTGGACATCCTGATCACAGGACAGATCCGTGCCAGACCCTTCCTCTCCGTGCGGCCGGGCCCCACAGTGGCCTCAGGAGAGAACGTGACCCTGCTGTGTCAGTCACAGGGAGGGATGCACACTTTCCTTTTGACCAAGGAGGGGGCAGCTGATTCCCCGCTGCGTCTAAAATCAAAGCGCCAATCTCATAAGTACCAGGCTGAATTCCCCATGAGTCCTGTGACCTCGGCCCACGCGGGGACCTACAGGTGCTACGGCTCACTCAGCTCCAACCCCTACCTGCTGACTCACCCCAGTGACCCCCTGGAGCTCGTGGTCTCAGGAGCAGCTGAGACCCTCAGCCCACCACAAAACAAGTCCGACTCCAAGGCTGGTGAGTGA
ORF Protein Sequence MTPILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA063-Ab Anti-LIRA3/ LILRA3/ CD85E monoclonal antibody
    Target Antigen GM-Tg-g-TA063-Ag LILRA3 VLP (virus-like particle)
    ORF Viral Vector pGMLP003697 Human LILRA3 Lentivirus plasmid
    ORF Viral Vector pGMLP004094 Human LILRA3 Lentivirus plasmid
    ORF Viral Vector vGMLP003697 Human LILRA3 Lentivirus particle
    ORF Viral Vector vGMLP004094 Human LILRA3 Lentivirus particle


    Target information

    Target ID GM-TA063
    Target Name LILRA3
    Gene ID 11026, 692337
    Gene Symbol and Synonyms CD85E,HM31,HM43,ILT-6,ILT6,LILRA3,LILRAD,LIR-4,LIR4
    Uniprot Accession Q8N6C8
    Uniprot Entry Name LIRA3_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000273884
    Target Classification Not Available

    This gene encodes a member of a family of immunoreceptors that are expressed predominantly in monocytes and B cells, and at lower levels in dendritic cells and natural killer cells. The encoded protein lacks the transmembrane region found in other members of this family. It acts as a soluble receptor for class I major histocompatibility complex (MHC) antigens. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and is polymorphic in human populations, with many individuals containing a deletion of this genomic region. [provided by RefSeq, Mar 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.