Human P2RX1/P2X1 ORF/cDNA clone-Lentivirus plasmid (NM_002558)
Cat. No.: pGMLP004449
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human P2RX1/P2X1 Lentiviral expression plasmid for P2RX1 lentivirus packaging, P2RX1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
P2RX1/P2X1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004449 |
Gene Name | P2RX1 |
Accession Number | NM_002558 |
Gene ID | 5023 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1200 bp |
Gene Alias | P2X1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCACGGCGGTTCCAGGAGGAGCTGGCCGCCTTCCTCTTCGAGTATGACACCCCCCGCATGGTGCTGGTGCGTAATAAGAAGGTGGGCGTTATCTTCCGACTGATCCAGCTGGTGGTCCTGGTCTACGTCATCGGGTGGGTGTTTCTCTATGAGAAGGGCTACCAGACCTCGAGCGGCCTCATCAGCAGTGTCTCTGTGAAACTCAAGGGCCTGGCCGTGACCCAGCTCCCTGGCCTCGGCCCCCAGGTCTGGGATGTGGCTGACTACGTCTTCCCAGCCCAGGGGGACAACTCCTTCGTGGTCATGACCAATTTCATCGTGACCCCGAAGCAGACTCAAGGCTACTGCGCAGAGCACCCAGAAGGGGGCATATGCAAGGAAGACAGTGGCTGTACCCCTGGGAAGGCCAAGAGGAAGGCCCAAGGCATCCGCACGGGCAAGTGTGTGGCCTTCAACGACACTGTGAAGACGTGTGAGATCTTTGGCTGGTGCCCCGTGGAGGTGGATGACGACATCCCGCGCCCTGCCCTTCTCCGAGAGGCCGAGAACTTCACTCTTTTCATCAAGAACAGCATCAGCTTTCCACGCTTCAAGGTCAACAGGCGCAACCTGGTGGAGGAGGTGAATGCTGCCCACATGAAGACCTGCCTCTTTCACAAGACCCTGCACCCCCTGTGCCCAGTCTTCCAGCTTGGCTACGTGGTGCAAGAGTCAGGCCAGAACTTCAGCACCCTGGCTGAGAAGGGTGGAGTGGTTGGCATCACCATCGACTGGCACTGTGACCTGGACTGGCACGTACGGCACTGCAGACCCATCTATGAGTTCCATGGGCTGTACGAAGAGAAAAATCTCTCCCCAGGCTTCAACTTCAGGTTTGCCAGGCACTTTGTGGAGAACGGGACCAACTACCGTCACCTCTTCAAGGTGTTTGGGATTCGCTTTGACATCCTGGTGGACGGCAAGGCCGGGAAGTTTGACATCATCCCTACAATGACCACCATCGGCTCTGGAATTGGCATCTTTGGGGTGGCCACAGTTCTCTGTGACCTGCTGCTGCTTCACATCCTGCCTAAGAGGCACTACTACAAGCAGAAGAAGTTCAAATACGCTGAGGACATGGGGCCAGGGGCGGCTGAGCGTGACCTCGCAGCTACCAGCTCCACCCTGGGCCTGCAGGAGAACATGAGGACATCCTGA |
ORF Protein Sequence | MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSGLISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEHPEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENGTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T69091-Ab | Anti-P2RX1/ P2X1 monoclonal antibody |
Target Antigen | GM-Tg-g-T69091-Ag | P2RX1 VLP (virus-like particle) |
ORF Viral Vector | pGMLP004449 | Human P2RX1 Lentivirus plasmid |
ORF Viral Vector | pGMPC000705 | Human P2RX1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP004449 | Human P2RX1 Lentivirus particle |
Target information
Target ID | GM-T69091 |
Target Name | P2RX1 |
Gene ID | 5023, 18436, 707658, 25505, 101091060, 491223, 514898, 100060689 |
Gene Symbol and Synonyms | P2RX1,P2x,P2X1,P2XMR,Pdcd3,RP-2 |
Uniprot Accession | P51575 |
Uniprot Entry Name | P2RX1_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000108405 |
Target Classification | Not Available |
The protein encoded by this gene belongs to the P2X family of G-protein-coupled receptors. These proteins can form homo-and heterotimers and function as ATP-gated ion channels and mediate rapid and selective permeability to cations. This protein is primarily localized to smooth muscle where binds ATP and mediates synaptic transmission between neurons and from neurons to smooth muscle and may being responsible for sympathetic vasoconstriction in small arteries, arterioles and vas deferens. Mouse studies suggest that this receptor is essential for normal male reproductive function. This protein may also be involved in promoting apoptosis. [provided by RefSeq, Jun 2013]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.