Human P2RX1/P2X1 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_002558)

Cat. No.: pGMPC000705
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human P2RX1/P2X1 Non-Viral expression plasmid (overexpression vector) for mouse P2RX1 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to P2RX1/P2X1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000705
Gene Name P2RX1
Accession Number NM_002558
Gene ID 5023
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 1200 bp
Gene Alias P2X1
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGCACGGCGGTTCCAGGAGGAGCTGGCCGCCTTCCTCTTCGAGTATGACACCCCCCGCATGGTGCTGGTGCGTAATAAGAAGGTGGGCGTTATCTTCCGACTGATCCAGCTGGTGGTCCTGGTCTACGTCATCGGGTGGGTGTTTCTCTATGAGAAGGGCTACCAGACCTCGAGCGGCCTCATCAGCAGTGTCTCTGTGAAACTCAAGGGCCTGGCCGTGACCCAGCTCCCTGGCCTCGGCCCCCAGGTCTGGGATGTGGCTGACTACGTCTTCCCAGCCCAGGGGGACAACTCCTTCGTGGTCATGACCAATTTCATCGTGACCCCGAAGCAGACTCAAGGCTACTGCGCAGAGCACCCAGAAGGGGGCATATGCAAGGAAGACAGTGGCTGTACCCCTGGGAAGGCCAAGAGGAAGGCCCAAGGCATCCGCACGGGCAAGTGTGTGGCCTTCAACGACACTGTGAAGACGTGTGAGATCTTTGGCTGGTGCCCCGTGGAGGTGGATGACGACATCCCGCGCCCTGCCCTTCTCCGAGAGGCCGAGAACTTCACTCTTTTCATCAAGAACAGCATCAGCTTTCCACGCTTCAAGGTCAACAGGCGCAACCTGGTGGAGGAGGTGAATGCTGCCCACATGAAGACCTGCCTCTTTCACAAGACCCTGCACCCCCTGTGCCCAGTCTTCCAGCTTGGCTACGTGGTGCAAGAGTCAGGCCAGAACTTCAGCACCCTGGCTGAGAAGGGTGGAGTGGTTGGCATCACCATCGACTGGCACTGTGACCTGGACTGGCACGTACGGCACTGCAGACCCATCTATGAGTTCCATGGGCTGTACGAAGAGAAAAATCTCTCCCCAGGCTTCAACTTCAGGTTTGCCAGGCACTTTGTGGAGAACGGGACCAACTACCGTCACCTCTTCAAGGTGTTTGGGATTCGCTTTGACATCCTGGTGGACGGCAAGGCCGGGAAGTTTGACATCATCCCTACAATGACCACCATCGGCTCTGGAATTGGCATCTTTGGGGTGGCCACAGTTCTCTGTGACCTGCTGCTGCTTCACATCCTGCCTAAGAGGCACTACTACAAGCAGAAGAAGTTCAAATACGCTGAGGACATGGGGCCAGGGGCGGCTGAGCGTGACCTCGCAGCTACCAGCTCCACCCTGGGCCTGCAGGAGAACATGAGGACATCCTGA
ORF Protein Sequence MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSGLISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEHPEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENGTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T69091-Ab Anti-P2RX1/ P2X1 monoclonal antibody
    Target Antigen GM-Tg-g-T69091-Ag P2RX1 VLP (virus-like particle)
    ORF Viral Vector pGMLP004449 Human P2RX1 Lentivirus plasmid
    ORF Viral Vector pGMPC000705 Human P2RX1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP004449 Human P2RX1 Lentivirus particle


    Target information

    Target ID GM-T69091
    Target Name P2RX1
    Gene ID 5023, 18436, 707658, 25505, 101091060, 491223, 514898, 100060689
    Gene Symbol and Synonyms P2RX1,P2x,P2X1,P2XMR,Pdcd3,RP-2
    Uniprot Accession P51575
    Uniprot Entry Name P2RX1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000108405
    Target Classification Not Available

    The protein encoded by this gene belongs to the P2X family of G-protein-coupled receptors. These proteins can form homo-and heterotimers and function as ATP-gated ion channels and mediate rapid and selective permeability to cations. This protein is primarily localized to smooth muscle where binds ATP and mediates synaptic transmission between neurons and from neurons to smooth muscle and may being responsible for sympathetic vasoconstriction in small arteries, arterioles and vas deferens. Mouse studies suggest that this receptor is essential for normal male reproductive function. This protein may also be involved in promoting apoptosis. [provided by RefSeq, Jun 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.