Human LGALS4/GAL4/L36LBP ORF/cDNA clone-Lentivirus plasmid (NM_006149)

Cat. No.: pGMLP004495
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LGALS4/GAL4/L36LBP Lentiviral expression plasmid for LGALS4 lentivirus packaging, LGALS4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to LGALS4/GAL4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $543
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004495
Gene Name LGALS4
Accession Number NM_006149
Gene ID 3960
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 972 bp
Gene Alias GAL4,L36LBP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCTATGTCCCCGCACCGGGCTACCAGCCCACCTACAACCCGACGCTGCCTTACTACCAGCCCATCCCGGGCGGGCTCAACGTGGGAATGTCTGTTTACATCCAAGGAGTGGCCAGCGAGCACATGAAGCGGTTCTTCGTGAACTTTGTGGTTGGGCAGGATCCGGGCTCAGACGTCGCCTTCCACTTCAATCCGCGGTTTGACGGCTGGGACAAGGTGGTCTTCAACACGTTGCAGGGCGGGAAGTGGGGCAGCGAGGAGAGGAAGAGGAGCATGCCCTTCAAAAAGGGTGCCGCCTTTGAGCTGGTCTTCATAGTCCTGGCTGAGCACTACAAGGTGGTGGTAAATGGAAATCCCTTCTATGAGTACGGGCACCGGCTTCCCCTACAGATGGTCACCCACCTGCAAGTGGATGGGGATCTGCAACTTCAATCAATCAACTTCATCGGAGGCCAGCCCCTCCGGCCCCAGGGACCCCCGATGATGCCACCTTACCCTGGTCCCGGACATTGCCATCAACAGCTGAACAGCCTGCCCACCATGGAAGGACCCCCAACCTTCAACCCGCCTGTGCCATATTTCGGGAGGCTGCAAGGAGGGCTCACAGCTCGAAGAACCATCATCATCAAGGGCTATGTGCCTCCCACAGGCAAGAGCTTTGCTATCAACTTCAAGGTGGGCTCCTCAGGGGACATAGCTCTGCACATTAATCCCCGCATGGGCAACGGTACCGTGGTCCGGAACAGCCTTCTGAATGGCTCGTGGGGATCCGAGGAGAAGAAGATCACCCACAACCCATTTGGTCCCGGACAGTTCTTTGATCTGTCCATTCGCTGTGGCTTGGATCGCTTCAAGGTTTACGCCAATGGCCAGCACCTCTTTGACTTTGCCCATCGCCTCTCGGCCTTCCAGAGGGTGGACACATTGGAAATCCAGGGTGATGTCACCTTGTCCTATGTCCAGATCTAA
ORF Protein Sequence MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2184-Ab Anti-LEG4/ LGALS4/ GAL4 monoclonal antibody
    Target Antigen GM-Tg-g-MP2184-Ag LGALS4 VLP (virus-like particle)
    ORF Viral Vector pGMLP004495 Human LGALS4 Lentivirus plasmid
    ORF Viral Vector vGMLP004495 Human LGALS4 Lentivirus particle


    Target information

    Target ID GM-MP2184
    Target Name LGALS4
    Gene ID 3960, 16855, 694195, 25474, 101100170, 614804, 100064337
    Gene Symbol and Synonyms gal-4,GAL4,L-36,L36LBI,L36LBP,LGALS4
    Uniprot Accession P56470
    Uniprot Entry Name LEG4_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000171747
    Target Classification Tumor-associated antigen (TAA)

    The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.