Human MS4A2/APY/ATOPY ORF/cDNA clone-Lentivirus plasmid (NM_000139)

Cat. No.: pGMLP004501
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MS4A2/APY/ATOPY Lentiviral expression plasmid for MS4A2 lentivirus packaging, MS4A2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to MS4A2/APY products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $483.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004501
Gene Name MS4A2
Accession Number NM_000139
Gene ID 2206
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 735 bp
Gene Alias APY,ATOPY,FCER1B,FCERI,IGEL,IGER,IGHER,MS4A1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACACAGAAAGTAATAGGAGAGCAAATCTTGCTCTCCCACAGGAGCCTTCCAGTGTGCCTGCATTTGAAGTCTTGGAAATATCTCCCCAGGAAGTATCTTCAGGCAGACTATTGAAGTCGGCCTCATCCCCACCACTGCATACATGGCTGACAGTTTTGAAAAAAGAGCAGGAGTTCCTGGGGGTAACACAAATTCTGACTGCTATGATATGCCTTTGTTTTGGAACAGTTGTCTGCTCTGTACTTGATATTTCACACATTGAGGGAGACATTTTTTCATCATTTAAAGCAGGTTATCCATTCTGGGGAGCCATATTTTTTTCTATTTCTGGAATGTTGTCAATTATATCTGAAAGGAGAAATGCAACATATCTGGTGAGAGGAAGCCTGGGAGCAAACACTGCCAGCAGCATAGCTGGGGGAACGGGAATTACCATCCTGATCATCAACCTGAAGAAGAGCTTGGCCTATATCCACATCCACAGTTGCCAGAAATTTTTTGAGACCAAGTGCTTTATGGCTTCCTTTTCCACTGAAATTGTAGTGATGATGCTGTTTCTCACCATTCTGGGACTTGGTAGTGCTGTGTCACTCACAATCTGTGGAGCTGGGGAAGAACTCAAAGGAAACAAGGTTCCAGAGGATCGTGTTTATGAAGAATTAAACATATATTCAGCTACTTACAGTGAGTTGGAAGACCCAGGGGAAATGTCTCCTCCCATTGATTTATAA
ORF Protein Sequence MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0842-Ab Anti-FCERB/ MS4A2/ APY monoclonal antibody
    Target Antigen GM-Tg-g-MP0842-Ag MS4A2 VLP (virus-like particle)
    ORF Viral Vector pGMLP004501 Human MS4A2 Lentivirus plasmid
    ORF Viral Vector vGMLP004501 Human MS4A2 Lentivirus particle


    Target information

    Target ID GM-MP0842
    Target Name MS4A2
    Gene ID 2206, 14126, 697830, 25316, 101101505, 403799, 531987, 100033954
    Gene Symbol and Synonyms APY,ATOPY,Fce1b,FCER1B,FCERI,FCIGA,FcRB,Fcrbeta,IGEL,IGER,IGHER,Ms4a1,MS4A2
    Uniprot Accession Q01362
    Uniprot Entry Name FCERB_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000149534
    Target Classification Not Available

    The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-linked gamma chains, is found on the surface of mast cells and basophils. This gene encodes the beta subunit of the high affinity IgE receptor which is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member is localized to 11q12, among a cluster of membrane-spanning 4A gene family members. Alternative splicing results in multiple transcript variants encoding distinct proteins. Additional transcript variants have been described but require experimental validation. [provided by RefSeq, Mar 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.