Human MS4A2/APY/ATOPY ORF/cDNA clone-Lentivirus particle (NM_000139)
Cat. No.: vGMLP004501
Pre-made Human MS4A2/APY/ATOPY Lentiviral expression plasmid for MS4A2 lentivirus packaging, MS4A2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
MS4A2/APY products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP004501 | Human MS4A2 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP004501 |
Gene Name | MS4A2 |
Accession Number | NM_000139 |
Gene ID | 2206 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 735 bp |
Gene Alias | APY,ATOPY,FCER1B,FCERI,IGEL,IGER,IGHER,MS4A1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGACACAGAAAGTAATAGGAGAGCAAATCTTGCTCTCCCACAGGAGCCTTCCAGTGTGCCTGCATTTGAAGTCTTGGAAATATCTCCCCAGGAAGTATCTTCAGGCAGACTATTGAAGTCGGCCTCATCCCCACCACTGCATACATGGCTGACAGTTTTGAAAAAAGAGCAGGAGTTCCTGGGGGTAACACAAATTCTGACTGCTATGATATGCCTTTGTTTTGGAACAGTTGTCTGCTCTGTACTTGATATTTCACACATTGAGGGAGACATTTTTTCATCATTTAAAGCAGGTTATCCATTCTGGGGAGCCATATTTTTTTCTATTTCTGGAATGTTGTCAATTATATCTGAAAGGAGAAATGCAACATATCTGGTGAGAGGAAGCCTGGGAGCAAACACTGCCAGCAGCATAGCTGGGGGAACGGGAATTACCATCCTGATCATCAACCTGAAGAAGAGCTTGGCCTATATCCACATCCACAGTTGCCAGAAATTTTTTGAGACCAAGTGCTTTATGGCTTCCTTTTCCACTGAAATTGTAGTGATGATGCTGTTTCTCACCATTCTGGGACTTGGTAGTGCTGTGTCACTCACAATCTGTGGAGCTGGGGAAGAACTCAAAGGAAACAAGGTTCCAGAGGATCGTGTTTATGAAGAATTAAACATATATTCAGCTACTTACAGTGAGTTGGAAGACCCAGGGGAAATGTCTCCTCCCATTGATTTATAA |
ORF Protein Sequence | MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0842-Ab | Anti-FCERB/ MS4A2/ APY monoclonal antibody |
Target Antigen | GM-Tg-g-MP0842-Ag | MS4A2 VLP (virus-like particle) |
ORF Viral Vector | pGMLP004501 | Human MS4A2 Lentivirus plasmid |
ORF Viral Vector | vGMLP004501 | Human MS4A2 Lentivirus particle |
Target information
Target ID | GM-MP0842 |
Target Name | MS4A2 |
Gene ID | 2206, 14126, 697830, 25316, 101101505, 403799, 531987, 100033954 |
Gene Symbol and Synonyms | APY,ATOPY,Fce1b,FCER1B,FCERI,FCIGA,FcRB,Fcrbeta,IGEL,IGER,IGHER,Ms4a1,MS4A2 |
Uniprot Accession | Q01362 |
Uniprot Entry Name | FCERB_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000149534 |
Target Classification | Not Available |
The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-linked gamma chains, is found on the surface of mast cells and basophils. This gene encodes the beta subunit of the high affinity IgE receptor which is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member is localized to 11q12, among a cluster of membrane-spanning 4A gene family members. Alternative splicing results in multiple transcript variants encoding distinct proteins. Additional transcript variants have been described but require experimental validation. [provided by RefSeq, Mar 2012]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.