Human EPPIN/CT71/CT72 ORF/cDNA clone-Lentivirus plasmid (NM_020398)
Cat. No.: pGMLP004546
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human EPPIN/CT71/CT72 Lentiviral expression plasmid for EPPIN lentivirus packaging, EPPIN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
EPPIN/CT71 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004546 |
Gene Name | EPPIN |
Accession Number | NM_020398 |
Gene ID | 57119 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 402 bp |
Gene Alias | CT71,CT72,dJ461P17.2,SPINLW1,WAP7,WFDC7 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGATCTTCTGGACTTTTGAGCCTCCTGGTGCTATTCGTCCTCTTAGCGAATGTCCAGGGACCTGGTCTGACTGATTGGTTATTTCCCAGGAGATGTCCCAAAATCAGAGAAGAATGTGAATTCCAAGAAAGGGATGTGTGTACAAAGGACAGACAATGCCAGGACAACAAGAAGTGTTGTGTCTTCAGCTGCGGAAAAAAATGTTTAGATCTCAAACAAGATGTATGCGAAATGCCAAAAGAAACTGGCCCCTGCCTGGCTTATTTTCTTCATTGGTGGTATGACAAGAAAGATAATACTTGCTCCATGTTTGTCTATGGTGGCTGCCAGGGAAACAATAACAACTTCCAATCCAAAGCCAACTGCCTGAACACCTGCAAGAATAAACGCTTTCCCTGA |
ORF Protein Sequence | MGSSGLLSLLVLFVLLANVQGPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0905-Ab | Anti-EPPI/ EPPIN/ CT71 functional antibody |
Target Antigen | GM-Tg-g-SE0905-Ag | EPPIN protein |
ORF Viral Vector | pGMLP004546 | Human EPPIN Lentivirus plasmid |
ORF Viral Vector | vGMLP004546 | Human EPPIN Lentivirus particle |
Target information
Target ID | GM-SE0905 |
Target Name | EPPIN |
Gene ID | 57119, 75526 |
Gene Symbol and Synonyms | 1700024E17Rik,CT71,CT72,dJ461P17.2,EPPIN,SPINLW1,WAP7,WFDC7 |
Uniprot Accession | O95925 |
Uniprot Entry Name | EPPI_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000101448 |
Target Classification | Not Available |
This gene encodes an epididymal protease inhibitor, which contains both kunitz-type and WAP-type four-disulfide core (WFDC) protease inhibitor consensus sequences. Most WFDC genes are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene is a member of the WFDC gene family and belongs to the telomeric cluster. The protein can inhibit human sperm motility and exhibits antimicrobial activity against E. coli, and polymorphisms in this gene are associated with male infertility. Read-through transcription also exists between this gene and the downstream WFDC6 (WAP four-disulfide core domain 6) gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.