Human EPPIN/CT71/CT72 ORF/cDNA clone-Lentivirus particle (NM_020398)

Cat. No.: vGMLP004546

Pre-made Human EPPIN/CT71/CT72 Lentiviral expression plasmid for EPPIN lentivirus packaging, EPPIN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to EPPIN/CT71 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004546 Human EPPIN Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004546
Gene Name EPPIN
Accession Number NM_020398
Gene ID 57119
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 402 bp
Gene Alias CT71,CT72,dJ461P17.2,SPINLW1,WAP7,WFDC7
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGATCTTCTGGACTTTTGAGCCTCCTGGTGCTATTCGTCCTCTTAGCGAATGTCCAGGGACCTGGTCTGACTGATTGGTTATTTCCCAGGAGATGTCCCAAAATCAGAGAAGAATGTGAATTCCAAGAAAGGGATGTGTGTACAAAGGACAGACAATGCCAGGACAACAAGAAGTGTTGTGTCTTCAGCTGCGGAAAAAAATGTTTAGATCTCAAACAAGATGTATGCGAAATGCCAAAAGAAACTGGCCCCTGCCTGGCTTATTTTCTTCATTGGTGGTATGACAAGAAAGATAATACTTGCTCCATGTTTGTCTATGGTGGCTGCCAGGGAAACAATAACAACTTCCAATCCAAAGCCAACTGCCTGAACACCTGCAAGAATAAACGCTTTCCCTGA
ORF Protein Sequence MGSSGLLSLLVLFVLLANVQGPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0905-Ab Anti-EPPI/ EPPIN/ CT71 functional antibody
    Target Antigen GM-Tg-g-SE0905-Ag EPPIN protein
    ORF Viral Vector pGMLP004546 Human EPPIN Lentivirus plasmid
    ORF Viral Vector vGMLP004546 Human EPPIN Lentivirus particle


    Target information

    Target ID GM-SE0905
    Target Name EPPIN
    Gene ID 57119, 75526
    Gene Symbol and Synonyms 1700024E17Rik,CT71,CT72,dJ461P17.2,EPPIN,SPINLW1,WAP7,WFDC7
    Uniprot Accession O95925
    Uniprot Entry Name EPPI_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000101448
    Target Classification Not Available

    This gene encodes an epididymal protease inhibitor, which contains both kunitz-type and WAP-type four-disulfide core (WFDC) protease inhibitor consensus sequences. Most WFDC genes are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene is a member of the WFDC gene family and belongs to the telomeric cluster. The protein can inhibit human sperm motility and exhibits antimicrobial activity against E. coli, and polymorphisms in this gene are associated with male infertility. Read-through transcription also exists between this gene and the downstream WFDC6 (WAP four-disulfide core domain 6) gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.