Human LHB/CGB4/HH23 ORF/cDNA clone-Lentivirus plasmid (NM_000894)

Cat. No.: pGMLP004554
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LHB/CGB4/HH23 Lentiviral expression plasmid for LHB lentivirus packaging, LHB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to LHB/CGB4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004554
Gene Name LHB
Accession Number NM_000894
Gene ID 3972
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 426 bp
Gene Alias CGB4,HH23,LSH-B,LSH-beta
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGATGCTCCAGGGGCTGCTGCTGTTGCTGCTGCTGAGCATGGGCGGGGCATGGGCATCCAGGGAGCCGCTTCGGCCATGGTGCCACCCCATCAATGCCATCCTGGCTGTCGAGAAGGAGGGCTGCCCAGTGTGCATCACCGTCAACACCACCATCTGTGCCGGCTACTGCCCCACCATGATGCGCGTGCTGCAGGCGGTCCTGCCGCCCCTGCCTCAGGTGGTGTGCACCTACCGTGATGTGCGCTTCGAGTCCATCCGGCTCCCTGGCTGCCCGCGTGGTGTGGACCCCGTGGTCTCCTTCCCTGTGGCTCTCAGCTGTCGCTGTGGACCCTGCCGCCGCAGCACCTCTGACTGTGGGGGTCCCAAAGACCACCCCTTGACCTGTGACCACCCCCAACTCTCAGGCCTCCTCTTCCTCTAA
ORF Protein Sequence MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1072-Ab Anti-LSHB/ LHB/ CGB4 functional antibody
    Target Antigen GM-Tg-g-SE1072-Ag LHB protein
    ORF Viral Vector pGMLP004554 Human LHB Lentivirus plasmid
    ORF Viral Vector vGMLP004554 Human LHB Lentivirus particle


    Target information

    Target ID GM-SE1072
    Target Name LHB
    Gene ID 3972, 16866, 100429401, 25329, 403959
    Gene Symbol and Synonyms CGB4,Gm29035,HH23,LH,LH-B,LHB,LSH-B,LSH-beta
    Uniprot Accession P01229
    Uniprot Entry Name LSHB_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Ovary Cancer, breast cancer
    Gene Ensembl ENSG00000104826
    Target Classification Not Available

    This gene is a member of the glycoprotein hormone beta chain family and encodes the beta subunit of luteinizing hormone (LH). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. LH is expressed in the pituitary gland and promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The genes for the beta chains of chorionic gonadotropin and for luteinizing hormone are contiguous on chromosome 19q13.3. Mutations in this gene are associated with hypogonadism which is characterized by infertility and pseudohermaphroditism. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.