Human LHB/CGB4/HH23 ORF/cDNA clone-Lentivirus particle (NM_000894)
Cat. No.: vGMLP004554
Pre-made Human LHB/CGB4/HH23 Lentiviral expression plasmid for LHB lentivirus packaging, LHB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
LHB/CGB4 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP004554 | Human LHB Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP004554 |
| Gene Name | LHB |
| Accession Number | NM_000894 |
| Gene ID | 3972 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 426 bp |
| Gene Alias | CGB4,HH23,LSH-B,LSH-beta |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGAGATGCTCCAGGGGCTGCTGCTGTTGCTGCTGCTGAGCATGGGCGGGGCATGGGCATCCAGGGAGCCGCTTCGGCCATGGTGCCACCCCATCAATGCCATCCTGGCTGTCGAGAAGGAGGGCTGCCCAGTGTGCATCACCGTCAACACCACCATCTGTGCCGGCTACTGCCCCACCATGATGCGCGTGCTGCAGGCGGTCCTGCCGCCCCTGCCTCAGGTGGTGTGCACCTACCGTGATGTGCGCTTCGAGTCCATCCGGCTCCCTGGCTGCCCGCGTGGTGTGGACCCCGTGGTCTCCTTCCCTGTGGCTCTCAGCTGTCGCTGTGGACCCTGCCGCCGCAGCACCTCTGACTGTGGGGGTCCCAAAGACCACCCCTTGACCTGTGACCACCCCCAACTCTCAGGCCTCCTCTTCCTCTAA |
| ORF Protein Sequence | MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1072-Ab | Anti-LSHB/ LHB/ CGB4 functional antibody |
| Target Antigen | GM-Tg-g-SE1072-Ag | LHB protein |
| ORF Viral Vector | pGMLP004554 | Human LHB Lentivirus plasmid |
| ORF Viral Vector | vGMLP004554 | Human LHB Lentivirus particle |
Target information
| Target ID | GM-SE1072 |
| Target Name | LHB |
| Gene ID | 3972, 16866, 100429401, 25329, 403959 |
| Gene Symbol and Synonyms | CGB4,Gm29035,HH23,LH,LH-B,LHB,LSH-B,LSH-beta |
| Uniprot Accession | P01229 |
| Uniprot Entry Name | LSHB_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Not Available |
| Disease | Ovary Cancer, breast cancer |
| Gene Ensembl | ENSG00000104826 |
| Target Classification | Not Available |
This gene is a member of the glycoprotein hormone beta chain family and encodes the beta subunit of luteinizing hormone (LH). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. LH is expressed in the pituitary gland and promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The genes for the beta chains of chorionic gonadotropin and for luteinizing hormone are contiguous on chromosome 19q13.3. Mutations in this gene are associated with hypogonadism which is characterized by infertility and pseudohermaphroditism. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


