Human CTAG1B/CT6.1/CTAG ORF/cDNA clone-Lentivirus plasmid (NM_001327)

Cat. No.: pGMLP004592
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CTAG1B/CT6.1/CTAG Lentiviral expression plasmid for CTAG1B lentivirus packaging, CTAG1B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to NY-ESO-1/CTAG1B/CT6.1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $435.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004592
Gene Name CTAG1B
Accession Number NM_001327
Gene ID 1485
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 543 bp
Gene Alias CT6.1,CTAG,CTAG1,ESO1,LAGE-2,LAGE2B,NY-ESO-1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGGCCGAAGGCCGGGGCACAGGGGGTTCGACGGGCGATGCTGATGGCCCAGGAGGCCCTGGCATTCCTGATGGCCCAGGGGGCAATGCTGGCGGCCCAGGAGAGGCGGGTGCCACGGGCGGCAGAGGTCCCCGGGGCGCAGGGGCAGCAAGGGCCTCGGGGCCGGGAGGAGGCGCCCCGCGGGGTCCGCATGGCGGCGCGGCTTCAGGGCTGAATGGATGCTGCAGATGCGGGGCCAGGGGGCCGGAGAGCCGCCTGCTTGAGTTCTACCTCGCCATGCCTTTCGCGACACCCATGGAAGCAGAGCTGGCCCGCAGGAGCCTGGCCCAGGATGCCCCACCGCTTCCCGTGCCAGGGGTGCTTCTGAAGGAGTTCACTGTGTCCGGCAACATACTGACTATCCGACTGACTGCTGCAGACCACCGCCAACTGCAGCTCTCCATCAGCTCCTGTCTCCAGCAGCTTTCCCTGTTGATGTGGATCACGCAGTGCTTTCTGCCCGTGTTTTTGGCTCAGCCTCCCTCAGGGCAGAGGCGCTAA
ORF Protein Sequence MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T82277-Ab Anti-NY-ESO-1 monoclonal antibody
    Target Antigen GM-Tg-g-T82277-Ag NY-ESO-1/CTAG1A protein
    ORF Viral Vector pGMLP004299 Human CTAG1A Lentivirus plasmid
    ORF Viral Vector pGMLP004592 Human CTAG1B Lentivirus plasmid
    ORF Viral Vector pGMLV002233 Human CTAG1B Lentivirus plasmid
    ORF Viral Vector vGMLP004299 Human CTAG1A Lentivirus particle
    ORF Viral Vector vGMLP004592 Human CTAG1B Lentivirus particle
    ORF Viral Vector vGMLV002233 Human CTAG1B Lentivirus particle


    Target information

    Target ID GM-T82277
    Target Name NY-ESO-1
    Gene ID 246100
    Gene Symbol and Synonyms CT6.1,CTAG1A,ESO1,LAGE-2,LAGE2A,NY-ESO-1
    Uniprot Accession P78358
    Uniprot Entry Name CTG1B_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease Not Available
    Gene Ensembl ENSG00000268651
    Target Classification Checkpoint-Immuno Oncology

    The protein encoded by this gene is a tumor cell antigen found in various types of cancers, which makes it a good candidate for a cancer vaccine. This gene is also highly expressed in normal ovary and testis tissues. An identical copy of this gene is found on the same chromosome. [provided by RefSeq, Dec 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.