Human CTAG1B/CT6.1/CTAG ORF/cDNA clone-Lentivirus particle (NM_001327)
Cat. No.: vGMLP004592
Pre-made Human CTAG1B/CT6.1/CTAG Lentiviral expression plasmid for CTAG1B lentivirus packaging, CTAG1B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
NY-ESO-1/CTAG1B/CT6.1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP004592 | Human CTAG1B Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP004592 |
Gene Name | CTAG1B |
Accession Number | NM_001327 |
Gene ID | 1485 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 543 bp |
Gene Alias | CT6.1,CTAG,CTAG1,ESO1,LAGE-2,LAGE2B,NY-ESO-1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCAGGCCGAAGGCCGGGGCACAGGGGGTTCGACGGGCGATGCTGATGGCCCAGGAGGCCCTGGCATTCCTGATGGCCCAGGGGGCAATGCTGGCGGCCCAGGAGAGGCGGGTGCCACGGGCGGCAGAGGTCCCCGGGGCGCAGGGGCAGCAAGGGCCTCGGGGCCGGGAGGAGGCGCCCCGCGGGGTCCGCATGGCGGCGCGGCTTCAGGGCTGAATGGATGCTGCAGATGCGGGGCCAGGGGGCCGGAGAGCCGCCTGCTTGAGTTCTACCTCGCCATGCCTTTCGCGACACCCATGGAAGCAGAGCTGGCCCGCAGGAGCCTGGCCCAGGATGCCCCACCGCTTCCCGTGCCAGGGGTGCTTCTGAAGGAGTTCACTGTGTCCGGCAACATACTGACTATCCGACTGACTGCTGCAGACCACCGCCAACTGCAGCTCTCCATCAGCTCCTGTCTCCAGCAGCTTTCCCTGTTGATGTGGATCACGCAGTGCTTTCTGCCCGTGTTTTTGGCTCAGCCTCCCTCAGGGCAGAGGCGCTAA |
ORF Protein Sequence | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T82277-Ab | Anti-NY-ESO-1 monoclonal antibody |
Target Antigen | GM-Tg-g-T82277-Ag | NY-ESO-1/CTAG1A protein |
ORF Viral Vector | pGMLP004299 | Human CTAG1A Lentivirus plasmid |
ORF Viral Vector | pGMLP004592 | Human CTAG1B Lentivirus plasmid |
ORF Viral Vector | pGMLV002233 | Human CTAG1B Lentivirus plasmid |
ORF Viral Vector | vGMLP004299 | Human CTAG1A Lentivirus particle |
ORF Viral Vector | vGMLP004592 | Human CTAG1B Lentivirus particle |
ORF Viral Vector | vGMLV002233 | Human CTAG1B Lentivirus particle |
Target information
Target ID | GM-T82277 |
Target Name | NY-ESO-1 |
Gene ID | 246100 |
Gene Symbol and Synonyms | CT6.1,CTAG1A,ESO1,LAGE-2,LAGE2A,NY-ESO-1 |
Uniprot Accession | P78358 |
Uniprot Entry Name | CTG1B_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target, Immuno-oncology Target |
Disease | Not Available |
Gene Ensembl | ENSG00000268651 |
Target Classification | Checkpoint-Immuno Oncology |
The protein encoded by this gene is a tumor cell antigen found in various types of cancers, which makes it a good candidate for a cancer vaccine. This gene is also highly expressed in normal ovary and testis tissues. An identical copy of this gene is found on the same chromosome. [provided by RefSeq, Dec 2015]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.