Human CTAG1B/CT6.1/CTAG ORF/cDNA clone-Lentivirus plasmid (NM_001327.3)
Cat. No.: pGMLV002233
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CTAG1B/CT6.1/CTAG Lentiviral expression plasmid for CTAG1B lentivirus packaging, CTAG1B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
NY-ESO-1/CTAG1B/CT6.1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV002233 |
| Gene Name | CTAG1B |
| Accession Number | NM_001327.3 |
| Gene ID | 1485 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 543 bp |
| Gene Alias | CT6.1,CTAG,CTAG1,ESO1,LAGE-2,LAGE2B,NY-ESO-1 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCAGGCCGAAGGCCGGGGCACAGGGGGTTCGACGGGCGATGCTGATGGCCCAGGAGGCCCTGGCATTCCTGATGGCCCAGGGGGCAATGCTGGCGGCCCAGGAGAGGCGGGTGCCACGGGCGGCAGAGGTCCCCGGGGCGCAGGGGCAGCAAGGGCCTCGGGGCCGGGAGGAGGCGCCCCGCGGGGTCCGCATGGCGGCGCGGCTTCAGGGCTGAATGGATGCTGCAGATGCGGGGCCAGGGGGCCGGAGAGCCGCCTGCTTGAGTTCTACCTCGCCATGCCTTTCGCGACACCCATGGAAGCAGAGCTGGCCCGCAGGAGCCTGGCCCAGGATGCCCCACCGCTTCCCGTGCCAGGGGTGCTTCTGAAGGAGTTCACTGTGTCCGGCAACATACTGACTATCCGACTGACTGCTGCAGACCACCGCCAACTGCAGCTCTCCATCAGCTCCTGTCTCCAGCAGCTTTCCCTGTTGATGTGGATCACGCAGTGCTTTCTGCCCGTGTTTTTGGCTCAGCCTCCCTCAGGGCAGAGGCGCTAA |
| ORF Protein Sequence | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T82277-Ab | Anti-NY-ESO-1 monoclonal antibody |
| Target Antigen | GM-Tg-g-T82277-Ag | NY-ESO-1/CTAG1A protein |
| ORF Viral Vector | pGMLP004299 | Human CTAG1A Lentivirus plasmid |
| ORF Viral Vector | pGMLP004592 | Human CTAG1B Lentivirus plasmid |
| ORF Viral Vector | pGMLV002233 | Human CTAG1B Lentivirus plasmid |
| ORF Viral Vector | vGMLP004299 | Human CTAG1A Lentivirus particle |
| ORF Viral Vector | vGMLP004592 | Human CTAG1B Lentivirus particle |
| ORF Viral Vector | vGMLV002233 | Human CTAG1B Lentivirus particle |
Target information
| Target ID | GM-T82277 |
| Target Name | NY-ESO-1 |
| Gene ID | 246100 |
| Gene Symbol and Synonyms | CT6.1,CTAG1A,ESO1,LAGE-2,LAGE2A,NY-ESO-1 |
| Uniprot Accession | P78358 |
| Uniprot Entry Name | CTG1B_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target, Immuno-oncology Target |
| Disease | Not Available |
| Gene Ensembl | ENSG00000268651 |
| Target Classification | Checkpoint-Immuno Oncology |
The protein encoded by this gene is a tumor cell antigen found in various types of cancers, which makes it a good candidate for a cancer vaccine. This gene is also highly expressed in normal ovary and testis tissues. An identical copy of this gene is found on the same chromosome. [provided by RefSeq, Dec 2015]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


