Human DUSP13/BEDP/DUSP13A ORF/cDNA clone-Lentivirus plasmid (NM_001007273)
Cat. No.: pGMLP004817
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human DUSP13/BEDP/DUSP13A Lentiviral expression plasmid for DUSP13 lentivirus packaging, DUSP13 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
DUSP13/BEDP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004817 |
Gene Name | DUSP13 |
Accession Number | NM_001007273 |
Gene ID | 51207 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 876 bp |
Gene Alias | BEDP,DUSP13A,DUSP13B,MDSP,SKRP4,TMDP |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGGCTCTGCCACTTTGCCACCCTGGCACTGATCCTGCTGGTGCTGCTGGAGGCTCTGGCCCAGGCGGACACACAGAAGATGGTGGAAGCCCAGCGTGGGGTCGGCCCTAGAGCCTGCTACTCCATCTGGCTCCTCCTGGCGCCTACACCCCCTCTCAGCCACTGTCTTCAGTCTCCACAGAAACAGCATCAAGTGTGCGGAGACAGGCGGCTGAAAGCCAGCAGCACGAACTGCCCGTCAGAGAAGTGCACAGCCTGGGCCAGATACTCCCACAGGATGGACTCACTGCAGAAGCAGGACCTCCGGAGGCCCAAGATCCATGGGGCAGTCCAGGCATCTCCCTACCAGCCGCCCACATTGGCTTCGCTGCAGCGCTTGCTGTGGGTCCGTCAGGCTGCCACACTGAACCATATCGATGAGGTCTGGCCCAGCCTCTTCCTGGGAGATGCGTACGCAGCCCGGGACAAGAGCAAGCTGATCCAGCTGGGAATCACCCACGTTGTGAATGCCGCTGCAGGCAAGTTCCAGGTGGACACAGGTGCCAAATTCTACCGTGGAATGTCCCTGGAGTACTATGGCATCGAGGCGGACGACAACCCCTTCTTCGACCTCAGTGTCTACTTTCTGCCTGTTGCTCGATACATCCGAGCTGCCCTCAGTGTTCCCCAAGGCCGCGTGCTGGTACACTGTGCCATGGGGGTAAGCCGCTCTGCCACACTTGTCCTGGCCTTCCTCATGATCTGTGAGAACATGACGCTGGTAGAGGCCATCCAGACGGTGCAGGCCCACCGCAATATCTGCCCTAACTCAGGCTTCCTCCGGCAGCTCCAGGTTCTGGACAACCGACTGGGGCGGGAGACGGGGCGGTTCTGA |
ORF Protein Sequence | MGLCHFATLALILLVLLEALAQADTQKMVEAQRGVGPRACYSIWLLLAPTPPLSHCLQSPQKQHQVCGDRRLKASSTNCPSEKCTAWARYSHRMDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGDAYAARDKSKLIQLGITHVVNAAAGKFQVDTGAKFYRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSVPQGRVLVHCAMGVSRSATLVLAFLMICENMTLVEAIQTVQAHRNICPNSGFLRQLQVLDNRLGRETGRF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP0731-Ab | Anti-DUSP13 monoclonal antibody |
Target Antigen | GM-Tg-g-IP0731-Ag | DUSP13 protein |
ORF Viral Vector | pGMLP004817 | Human DUSP13 Lentivirus plasmid |
ORF Viral Vector | pGMAAV001531 | Human DUSP13 Adeno-associate virus(AAV) plasmid |
ORF Viral Vector | vGMLP004817 | Human DUSP13 Lentivirus particle |
ORF Viral Vector | vGMAAV001531 | Human DUSP13 Adeno-associate virus(AAV) particle |
Target information
Target ID | GM-IP0731 |
Target Name | DUSP13 |
Gene ID | 51207, 27389, 704480, 361002, 101091309, 489054, 616048, 100072931 |
Gene Symbol and Synonyms | DUSP13,DUSP13A,DUSP13B,Gm1203,LMW-DSP6,MDSP,SKRP4,TMDP,TS-DSP6 |
Uniprot Accession | Q6B8I1, Q9UII6 |
Uniprot Entry Name | DS13A_HUMAN,DS13B_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000079393 |
Target Classification | Not Available |
Members of the protein-tyrosine phosphatase superfamily cooperate with protein kinases to regulate cell proliferation and differentiation. This superfamily is separated into two families based on the substrate that is dephosphorylated. One family, the dual specificity phosphatases (DSPs) acts on both phosphotyrosine and phosphoserine/threonine residues. This gene encodes different but related DSP proteins through the use of non-overlapping open reading frames, alternate splicing, and presumed different transcription promoters. Expression of the distinct proteins from this gene has been found to be tissue specific and the proteins may be involved in postnatal development of specific tissues. A protein encoded by the upstream ORF was found in skeletal muscle, whereas the encoded protein from the downstream ORF was found only in testis. In mouse, a similar pattern of expression was found. Multiple alternatively spliced transcript variants were described, but the full-length sequence of only some were determined. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.