Human DUSP13/BEDP/DUSP13A ORF/cDNA clone-Lentivirus plasmid (NM_001007273)

Cat. No.: pGMLP004817
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human DUSP13/BEDP/DUSP13A Lentiviral expression plasmid for DUSP13 lentivirus packaging, DUSP13 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to DUSP13/BEDP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $519
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004817
Gene Name DUSP13
Accession Number NM_001007273
Gene ID 51207
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 876 bp
Gene Alias BEDP,DUSP13A,DUSP13B,MDSP,SKRP4,TMDP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGCTCTGCCACTTTGCCACCCTGGCACTGATCCTGCTGGTGCTGCTGGAGGCTCTGGCCCAGGCGGACACACAGAAGATGGTGGAAGCCCAGCGTGGGGTCGGCCCTAGAGCCTGCTACTCCATCTGGCTCCTCCTGGCGCCTACACCCCCTCTCAGCCACTGTCTTCAGTCTCCACAGAAACAGCATCAAGTGTGCGGAGACAGGCGGCTGAAAGCCAGCAGCACGAACTGCCCGTCAGAGAAGTGCACAGCCTGGGCCAGATACTCCCACAGGATGGACTCACTGCAGAAGCAGGACCTCCGGAGGCCCAAGATCCATGGGGCAGTCCAGGCATCTCCCTACCAGCCGCCCACATTGGCTTCGCTGCAGCGCTTGCTGTGGGTCCGTCAGGCTGCCACACTGAACCATATCGATGAGGTCTGGCCCAGCCTCTTCCTGGGAGATGCGTACGCAGCCCGGGACAAGAGCAAGCTGATCCAGCTGGGAATCACCCACGTTGTGAATGCCGCTGCAGGCAAGTTCCAGGTGGACACAGGTGCCAAATTCTACCGTGGAATGTCCCTGGAGTACTATGGCATCGAGGCGGACGACAACCCCTTCTTCGACCTCAGTGTCTACTTTCTGCCTGTTGCTCGATACATCCGAGCTGCCCTCAGTGTTCCCCAAGGCCGCGTGCTGGTACACTGTGCCATGGGGGTAAGCCGCTCTGCCACACTTGTCCTGGCCTTCCTCATGATCTGTGAGAACATGACGCTGGTAGAGGCCATCCAGACGGTGCAGGCCCACCGCAATATCTGCCCTAACTCAGGCTTCCTCCGGCAGCTCCAGGTTCTGGACAACCGACTGGGGCGGGAGACGGGGCGGTTCTGA
ORF Protein Sequence MGLCHFATLALILLVLLEALAQADTQKMVEAQRGVGPRACYSIWLLLAPTPPLSHCLQSPQKQHQVCGDRRLKASSTNCPSEKCTAWARYSHRMDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGDAYAARDKSKLIQLGITHVVNAAAGKFQVDTGAKFYRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSVPQGRVLVHCAMGVSRSATLVLAFLMICENMTLVEAIQTVQAHRNICPNSGFLRQLQVLDNRLGRETGRF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0731-Ab Anti-DUSP13 monoclonal antibody
    Target Antigen GM-Tg-g-IP0731-Ag DUSP13 protein
    ORF Viral Vector pGMLP004817 Human DUSP13 Lentivirus plasmid
    ORF Viral Vector pGMAAV001531 Human DUSP13 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMLP004817 Human DUSP13 Lentivirus particle
    ORF Viral Vector vGMAAV001531 Human DUSP13 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-IP0731
    Target Name DUSP13
    Gene ID 51207, 27389, 704480, 361002, 101091309, 489054, 616048, 100072931
    Gene Symbol and Synonyms DUSP13,DUSP13A,DUSP13B,Gm1203,LMW-DSP6,MDSP,SKRP4,TMDP,TS-DSP6
    Uniprot Accession Q6B8I1, Q9UII6
    Uniprot Entry Name DS13A_HUMAN,DS13B_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000079393
    Target Classification Not Available

    Members of the protein-tyrosine phosphatase superfamily cooperate with protein kinases to regulate cell proliferation and  differentiation. This superfamily is separated into two families based on the substrate that is dephosphorylated. One family, the dual specificity phosphatases (DSPs) acts on both phosphotyrosine and phosphoserine/threonine residues. This gene encodes different but related DSP proteins through the use of non-overlapping open reading frames, alternate splicing, and presumed different transcription promoters. Expression of the distinct proteins from this gene has been found to be tissue specific and the proteins may be involved in postnatal development of specific tissues. A protein encoded by the upstream ORF was found in skeletal muscle, whereas the encoded protein from the downstream ORF was found only in testis. In mouse, a similar pattern of expression was found. Multiple alternatively spliced transcript variants were described, but the full-length sequence of only some were determined. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.